RetrogeneDB ID:
retro_mputfur_278
Organism:
Location:
GL896901.1:13119614-13120038 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
67.12 %
Coverage:
54.92 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
RPS3A
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S3A [Source:HGNC Symbol;Acc:10421]

Genomic region (view in browser)





>retro_mputfur_278
ACCAAGACTGAAGCTCATTTCGATGTCAGGATTACCAGAGATTACTTGTTTTCTCTGTTT
TGTGTTGGTTCTACTGAAAAAATGCAACAGTCAGATTCAGAAGACCTCTTACGCTCAGCA
CCAACAGGTTCACCAGATTTGGGAAAAGATGATGGAAATCATGACCCAAGAGCTGTAGAC
CAACAGCTTGAAAGAAGCCGTCAGTAAATTGTTTGCAGACAGCACTGAAGAACACATAGA
AAACACTTCTCATCCACCCCACGATGTCTTTGTTAGAAAAGCAAAAATGCTGAAGAAGCC
CAGGTTTGAACTGGGAAAGCTCCTGGAGCTTCATGGTGAAGGTGGTAGGTCTGGGAAAGC
TCCTGGGGATGAGACCAGTGCAGCTGAACAAGCTTGTGGATATGAGCCGCCAGTCCAAGA
ATCT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TMIEAHVDVKTTDGYLLRLFCVGFT-KKRNNQIRKTSYAQHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEKACQSIYPLHDVFVRKVKM
T..EAH.DV..T..YL..LFCVG.T.KK.N.QI.KTSYAQHQQV.QI..KMMEIMT.E..TN.LKE.V.KL..DS....IE.......P.HDVFVRK.KM
Retrocopy
TKTEAHFDVRITRDYLFSLFCVGST\KKCNSQIQKTSYAQHQQVHQIWEKMMEIMTQEL*TNSLKEAVSKLFADSTEEHIENTS---HPPHDVFVRKAKM


Parental protein
LKKPKFELGKLMELHGEGSSSGKATGDETGAKVERADGYEPPVQES
LKKP.FELGKL.ELHGEG..SGKA.GDET.A..E.A.GYEPPVQES
Retrocopy
LKKPRFELGKLLELHGEGGRSGKAPGDETSA-AEQACGYEPPVQES


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide