RetrogeneDB ID:
retro_mputfur_279
Organism:
Location:
GL896901.1:17582761-17583881 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
72.06 %
Coverage:
100.0 %
Frameshifts:
7
Stop codons:
4


Parental gene:
Parental gene symbol:
ACTG1
Parental gene aliases:
No gene alias available
Parental gene description:
actin, gamma 1 [Source:HGNC Symbol;Acc:144]

Genomic region (view in browser)





>retro_mputfur_279
ATGGAAGAGGAGATGATTGCGCTCGCCGTCCACTATGGCCCCAGGATGTGCAAGGCAGAC
TTTGCCGGGGATGGTTCCCACCCGAGCTACGCTCCTGTCCATCGTCGGGTGATCCCGACA
CCAGGGCGTGATGGTTGGAATGGGCCAAAAGGACTCTTACATTGGCGACAAGGCCCAGAG
CAAGCGGGGCATCCTGACCCTCCCGTACCCCGTCGAGCACGGCACTGTCACCAACTGAGA
CAATGTGGAGATCTGGCACCATACCTTCCACAACGAGCTGCGCATGGCCCCTGAGGAGCA
CCCGTGCTGCTGACCGAGGCCCCCGGAACCCCAAGGGCAACTGTGGGATGACTCAGATCA
TTTTTGAGACCTTCAACACCCCAGGCATGTATGTGGTCATCCGGGCTGTGCTGTCCCTGC
ATGGCTCTGGCCGCACCACTGGTCTTGTCATGGACTCTGGGGACAGGGTCACCCACACTG
TGCCCATCTTCGCAGGGTACGCCCTGCCCCCGCGCCATCCTGCGTCAGGACCTAGCTGGC
CGGGACCTGACGGACTAGTTTATGAAGAGCCTCTCCGAGTGTGGCTGCCGCTTCGCCGCC
GCCGCCGCGTAGCGGGGAATAGTGCGTGACATCAAGGGGAAGCTCTGCTCGGTCGTCCTG
GACGTCGAGCAGGAGATGGTCACGGCCGTGTCCTCCTCCTCCCTGGAGAAGAGCTATGAG
CTGCCCCACAAGGCAGGTGATCACTGTCCGGAGCGAGCAGTTCCGCTGCCCGCAGGCGCT
CTTCCAGCCTTCCTTCCTGGGGATGGGGTCGGGTAGTGTCCACGAGACCACCTTCCGCTC
CATCAGAAGTGTGACGTCGACATCCGGAAGGCCCTCTATGCTCGCGCGGTGCTGCGGGGC
GGGGCCACCGTGTACCCCTGCATCGCCGACAGGATGCAGAAGATCACAACTCTGGCGCCA
AGCACCATGAAGGTCAAGATCACCGCTCCTCCGGAACGCAAGTCCTGGGTGTGGGTCGGG
GGCGCCCTCCCGGCCTCGCTGTCCACCTCCCAGCAGATGTGGATCAGCAAGCAGGAGGAT
GTTGGAGTCGGGCCCCTCCGTTGTGCACTGTAAATACTTT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MEEEIAALVIDNGSGMCKAGFAGDDA-PRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE
MEEE..AL....G..MCKA.FAGD....RA...SIVG..RHQGVMVGMGQKDSY.GD.AQSKRGILTL.YP.EHG.VTN.D..E.IWHHTF.NELR.APE
Retrocopy
MEEEMIALAVHYGPRMCKADFAGDGS\TRATLLSIVG*SRHQGVMVGMGQKDSYIGDKAQSKRGILTLPYPVEHGTVTN*DNVE-IWHHTFHNELRMAPE


Parental protein
EHP-VLLTEAP-LNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYAL-PHAILRLDLAGRDLTDYLMKILTER
EHP.VLLTEAP..NPK.N...MTQI.FETFNTP.MYV.I.AVLSL..SGRTTG.VMDSGD.VTHTVPI..GYAL.P.AILR.DLAGRDLTD..MK.L.E.
Retrocopy
EHP/VLLTEAP/RNPKGNCG-MTQIIFETFNTPGMYVVIRAVLSLHGSGRTTGLVMDSGDRVTHTVPIFAGYAL\PRAILRQDLAGRDLTD*FMKSLSEC


Parental protein
GYSFTTTAE-REIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYEL-PDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSI-MKCDVDIRKDL
G..F...A..R.IVRDIK.KLC.V.LD.EQEM.TA.SSSSLEKSYEL.P..QVIT...E.FRCP.ALFQPSFLGM.S...HETTF.SI..KCDVDIRK.L
Retrocopy
GCRFAAAAA*RGIVRDIKGKLCSVVLDVEQEMVTAVSSSSLEKSYEL\PTRQVITVRSEQFRCPQALFQPSFLGMGSGSVHETTFRSI/QKCDVDIRKAL


Parental protein
YANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQE-YDESGPSIVHRKCF
YA..VL.GG.T.YP.IADRMQK.IT.LAPSTMK.KI.APPERK..VW.GG...ASLST.QQMWISKQE...ESGPS.VH.K.F
Retrocopy
YARAVLRGGATVYPCIADRMQK-ITTLAPSTMKVKITAPPERKSWVWVGGALPASLSTSQQMWISKQE\MLESGPSVVHCKYF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide