RetrogeneDB ID:
retro_mputfur_280
Organism:
Location:
GL896901.1:17686577-17687479 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
74.52 %
Coverage:
51.17 %
Frameshifts:
5
Stop codons:
3


Parental gene:
Parental gene symbol:
WBP11
Parental gene aliases:
No gene alias available
Parental gene description:
WW domain binding protein 11 [Source:HGNC Symbol;Acc:16461]

Genomic region (view in browser)





>retro_mputfur_280
GTGCCATGTTTGCCCCCTGGCAGAAAACCTCCTGGTCCCACCACCTCCTAAAGCCTTGCA
AATATATGGCTGTAAATTGGGCTTTGCCCTAGATCTTCCCCCTCGTAGGCAGGATGAAGA
CTTGTTATATAGCCCAGAACTTGCTCATCGGGGTCATGATGATGATGTTTCCAGCTCCAG
TGAAGATGATGGGTATCCTGAGGACATGGATCAAGATAAGCATGATGACAATACTGATGA
CAGTGACACTGACAGATCAGATGGAGAACGTGAAGGGGATGACCTTGTGGATGTGATGAT
AATGAGAGAGACAACAACGAAGGAAAAAAGTCAGGTCTGAGTGTGAGATTTGCAGATATG
CCTGGAAAATCAGGAAGAAAAAGAAGAACATGAAGGAACTGACTCCCCTTCAAGCTGTGA
TGCTTTGAAGGGCAGGTCAGGAAATCCCCGAGTAGGGACGAGAAGTAGAAGAATTTTCAG
AGGATGATGACAAAGATGATTCTGATGATTCTGAAGCAGAAGAGCAATCACAAAAACAGC
ATAAAGAGGAATCTCCTTCTGATGGCACATCTACTGCTCCTTCACAGCAGCAACCCCCAC
CCCCCAGTCTGTTCCCTCCTCCTCAGATTCAAGCACCTCCCATGCTGGGACTGCCTCCTC
TTGGACCACCCCTGGCTCCACCCTCAACCTCCCACGGGCCTTACTCCTGGACCACCTCTA
GGAGCTCCTCCATTCCTGAGACTGCCTGAAATGTCGGGACTCTGAGGACCTTTACCCCCC
AACTTTTGCCTCTAGGCCCACCACCAGGCCGATCTCATGGCCCTCCCCCAGGTTCACCTC
CAGGTCTGCCTCCTGGCCCTCCTCCTCGGGGACCCCCACCAAGGCTCCTTGGTGCATCTC
CC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VPRLPPGRKPPGPPPGP-PPPQVLQMYGRKVGFALDLPPRRRDEDMLYSPELAQRGHDDDVSSTSEDDGYPEDMDQDKHDDSTDDSDTDRSDGESEGDEF
VP.LPPGRK....PPGP.PPP..LQ.YG.K.GFALDLPPRR.DED.LYSPELA.RGHDDDVSS.SEDDGYPEDMDQDKHDD.TDDSDTDRSDGE.EGD..
Retrocopy
VPCLPPGRK----PPGP\PPPKALQIYGCKLGFALDLPPRRQDEDLLYSPELAHRGHDDDVSSSSEDDGYPEDMDQDKHDDNTDDSDTDRSDGEREGDDL


Parental protein
VH-RDDNERDNNEEKKSGLSVRFADMPGKS-RKKKKNMKELTPLQAMMLRMAGQEIPEEGREVEEFSEDDDEDDSDDSEAEKQSQKQHKEEALSDGTSTA
V...DDNERDNNE.KKSGLSVRFADMPGKS.RKKKKNMKELTPLQA.ML..AGQEIPE.GREVEEFSEDDD........AE.QSQKQHKEE..SDGTSTA
Retrocopy
VD/CDDNERDNNEGKKSGLSVRFADMPGKS/RKKKKNMKELTPLQAVML*RAGQEIPE*GREVEEFSEDDDKXXXXXXXAEEQSQKQHKEESPSDGTSTA


Parental protein
SSQQQAPPQSV-PPSQIQAPPMPGPPPLGPPPAPPLRPPGP-PTGLPPGPPPGAPPFLRPPGMPGLRGPLP-RLLPPGPPP-GRPPGPPPGPPPGLPPGP
.SQQQ.PP.S..PP.QIQAPPM.G.PPLGPP.APP....GP...G.P.G.PP....FLR.P.M.GL.GPLP...L.P..PP.GR..GPPPG.PPGLPPGP
Retrocopy
PSQQQPPPPSLFPPPQIQAPPMLGLPPLGPPLAPPSTSHGP\TPGPPLGAPP----FLRLPEMSGL*GPLP/PQLLPLGPPPGRSHGPPPGSPPGLPPGP


Parental protein
PPRGPPPRLPPPAP
PPRGPPPRL....P
Retrocopy
PPRGPPPRLLGASP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide