RetrogeneDB ID:
retro_mputfur_283
Organism:
Location:
GL896901.1:27569639-27570062 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
56.38 %
Coverage:
89.44 %
Frameshifts:
5
Stop codons:
2


Parental gene:
Parental gene symbol:
RPS16
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S16 [Source:HGNC Symbol;Acc:10396]

Genomic region (view in browser)





>retro_mputfur_283
TCCAAGGGACGTCTGCAGTCTATGCATGTCTTCAGATGCAAGAAAACTGCCGCACCGTGC
CACACTGCAAACGTGGCAAATGCCTCATCAAAGGGAACGTGAGGCCCCTAATCCAGCCAC
ACTTGCTACAGTAGAAGCTACTGGACCTGTTCTGCTCCTGAGCAATGAGCTATTCACCTG
TGAGGACCTTCGAGACTGACGGAGGGGCGTGGTCACGTGGCCCGGATTTCTACAATCTCC
GATTCACCTCGAATTGGAGAGTGGCCCATTACCAGGAGCACATTGGTGAGGCTTCCAAGG
GAGCCACCAAAGACATCCTCATACAATATGATCAGATCCTGTCGGTGGCTGATCCCCATT
GCTGCTAATCCTGGAAAGTTCCGAGGGCTTGGTGCCAGTGCTTGCTACCAGAAATCCTAC
AAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SKGPLQSVQVFGRKKTAT-AVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLE-PVLLLGKERFAGVDIRV-RVKGGGHVAQIYAIRQS-ISKALVAYYQK
SKG.LQS..VF..KKTA...V.HCKRG..LIK.N.RPL..I.P..LQ.KLL..PVLLL..E.F...D.R.....G.GHVA.I..I..S..S...VA.YQ.
Retrocopy
SKGRLQSMHVFRCKKTAA/TVPHCKRGKCLIKGNVRPL--IQPHLLQ*KLLD/PVLLLSNELFTCEDLRD/LTEGRGHVARISTISDS/TSNWRVAHYQE


Parental protein
YVDEASKKEIKDILIQYDRTLLVADPRRCES-KKFGGPGARARYQKSYR
...EASK...KDILIQYD..L.VADP..C.S..KF.G.GA.A.YQKSY.
Retrocopy
HIGEASKGATKDILIQYDQILSVADPHCC*S\GKFRGLGASACYQKSYK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide