RetrogeneDB ID:
retro_mputfur_285
Organism:
Location:
GL896901.1:7134554-7134863 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
98.06 %
Coverage:
58.19 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
PPIH
Parental gene aliases:
No gene alias available
Parental gene description:
peptidylprolyl isomerase H (cyclophilin H) [Source:HGNC Symbol;Acc:14651]

Genomic region (view in browser)





>retro_mputfur_285
CAGGGTGGGGATTTTGTTAATGGAGATGGTACTGGAGTTGCCAGTATTTACCGGGGGCCA
TTTGCAGATGAAAATTTTAAACTCAGACACTCAGCTCCAGGCCTGCTTTCCATGGCAAAC
AGCAGTCCCAGTACAAATGGCTGCCAGTTCTTCATCACCTGCTCTAAATGTGATTGGCTG
GATGGGAAACACGTAGTGTTTGGAAAAATCATTGATGGACTTCTAGTGATGCGAAAGATA
GAGAATGTTCCCACAGGCCCCAACAATAAGCCCAAGCTGCCTGTGGTGATCTCACAGTAT
GGGGAGATG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQC
QGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANS.PSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQ.
Retrocopy
QGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSSPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQY


Parental protein
GEM
GEM
Retrocopy
GEM


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide