RetrogeneDB ID:
retro_mputfur_293
Organism:
Location:
GL896901.1:33273874-33274531 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
60.99 %
Coverage:
65.76 %
Frameshifts:
2
Stop codons:
4


Parental gene:
Parental gene symbol:
YBX1
Parental gene aliases:
No gene alias available
Parental gene description:
Y box binding protein 1 [Source:HGNC Symbol;Acc:8014]

Genomic region (view in browser)





>retro_mputfur_293
CCCCAGAGAGCCCTGAGCAGCCCTATCAACCCCCACTGGCCTTGTTATCATCACACCTGG
GGAGACAGCCACAGCTGCCACGGACTCACATCCTGGCCTGCCATTGGGGATAAGAAGGTC
ATCACAAGGAAGATTTTGGGAACAGTAAAATGGTTGAGTGTGAGAAATGGGTATGGCTTC
ATCAACAGGAATGACAGCAAGGAAGATGTGTTTGTATACCAGACTGCCATAAAGAACAAT
AATCCTGGGAGGCGCCGTCCCAGTGGAGGAGGTGGAGAGATGGTGTAGTTGGATGTTGTC
GAAGGAGAAAAGGGTGTGGAGGCGGCAAATGTGATAGGCTGTTGTTGAGTTCCAGTGCAA
GGCAGTAAATATGCAGCAGACTGGAACCATCATAGACATTCTCCACGATGCCGGGGTCCT
CCACACATTTACCAGCAGAATTACAGAACAGTGAGAGTGGGGAAAAGGAGGGTTGGGAAA
GTGTTCCTGAAGGCCAGGTCCCAACAGCACCAGCCCTACCACCGGTGACAGTTCCCACCT
TACTGCATGTGCAGACCCTCTGGGTATCAACCACAGTCTTCCAATCCTCCTTTGTGGGGA
GAAGTGATGGAAGGTGCTGACAACCAGGATGCAGGAGAACAAGACTGACCAGTGAGA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PARALSQSL--HRP--HGALARGGTAGGAVAAPAGPDSKTLESLILGKVKWHQINNGWLFLRRLNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDV
P.RALS.....H.P..H..........G....PA..D.K.....ILG.VKW....NG..F..R.ND.KEDVFV.QTAIK.NNP.....S.G.GE.V..DV
Retrocopy
PQRALSSPINPHWPCYHHTWGDSHSCHGLTSWPAIGDKKVITRKILGTVKWLSVRNGYGFINR-NDSKEDVFVYQTAIKNNNPGRRRPSGGGGEMV*LDV


Parental protein
VEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRHRGPPHNYQQNY-QNSESGEKNEGSESAPEGQ-AQQRRPYRRRRFPPYYMRRPYGRRPQYSNP
VEGEKG.EAANV.G...VPVQGSKYAAD.NH.R..PR.RGPPH.YQQNY.QNSESGEK.EG.ES.PEGQ..QQ..PY.R..FPPY.M.RP.G..PQ.SNP
Retrocopy
VEGEKGVEAANVIGCC*VPVQGSKYAADWNHHRHSPRCRGPPHIYQQNY/QNSESGEK-EGWESVPEGQ\SQQHQPYHR*QFPPYCMCRPSGYQPQSSNP


Parental protein
PVQGEVMEGADNQGAGEQGRPVR
P..GEVMEGADNQ.AGEQ..PVR
Retrocopy
PLWGEVMEGADNQDAGEQD*PVR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide