RetrogeneDB ID:
retro_mputfur_294
Organism:
Location:
GL896902.1:836516-837032 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
99.42 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
MYL12B
Parental gene aliases:
No gene alias available
Parental gene description:
myosin, light chain 12B, regulatory [Source:HGNC Symbol;Acc:29827]

Genomic region (view in browser)





>retro_mputfur_294
ATGTCGAGCAAAAAGGCAAAGACTAAGACCACCAAGAAGCGCCCCCAGCGCGCAACATCC
AACGTATTCGCCATGTTTGACCAGTCACAGATTCAGGAGTTCAAAGAGGCCTTCAACATG
ATTGATCAGAACAGAGATGGTTTCATTGACAAGGAGGATTTGCATGATATGCTTGCTTCT
CTAGGGAAGAATCCAACCGATGCATACCTTGAGGCCATGATGAATGAGGCTCCAGGGCCC
ATAAATTTTACCATGTTCCTCACAATGTTTGGTGAGAAGTTAAATGGCACAGATCCAGAA
GATGTCATCAGAAACGCTTTTGCATGCTTTGATGAAGAAGCAACTGGCACCATCCAGGAA
GATTACCTGAGAGAGCTGCTGACAACCATGGGAGATCGGTTTACAGACGAGGAGGTGGAT
GAGCTGTACAGAGAAGCACCTATCGACAAAAAGGGAAATTTCAATTATATCGAATTCACG
CGCATCCTTAAACATGGAGCAAAAGACAAAGATGAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYLEAMMNEAPGPINFTMFLTMFGEKLNGTDPE
MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYLEAMMNEAPGPINFTMFLTMFGEKLNGTDPE
Retrocopy
MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYLEAMMNEAPGPINFTMFLTMFGEKLNGTDPE


Parental protein
DVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKQGNFNYIEFTRILKHGAKDKDD
DVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDK.GNFNYIEFTRILKHGAKDKDD
Retrocopy
DVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide