RetrogeneDB ID:
retro_mputfur_295
Organism:
Location:
GL896902.1:1209075-1209448 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
61.83 %
Coverage:
99.21 %
Frameshifts:
5
Stop codons:
2


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
Activated RNA polymerase II transcriptional coactivator p15 [Source:UniProtKB/TrEMBL;Acc:G9KZW1]

Genomic region (view in browser)





>retro_mputfur_295
ATGTCTAAATCAAAGGAACCTGTTTCTTCAAACTCTTCTAGCAGCAATTCTGACAGTGAG
GTTGACAAAAAGTTAAAGAGGAAAAAGCAAGTTGCTCCAGAAAAATCTGTGAAGAAGCAA
GACTGGTGAAACTTCAAGAGCCCTGTCATCTACTGAGCAGAGCAGCAACAGAAACAATAT
AACATGTTTCAGACCCAGAAAATGAGGTAGGTCCATGTTAAGGACTTTAAAGGGAAAGTT
CTAACTGATATTAAAGAACACTGGATGTATCAAAAGGTGAAATGAAACCTGAAAGAAAAG
GTATTCCTTTAATTTCTGAGCAATGGAGCCAGCTGAAGAAAAGATTTCTGACATTAACGA
TAAAGCAAAAGAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MPKSKELVSSSSSGSDSDSEVDK-KLK-RKKQVTPEKPVKKQKTGETSRALSSSKQSSS-SRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPE-GEM
M.KSKE.VSS.SS.S.SDSEVDK.K.K.R.K.....K.....KTGETSRALSS..QSS......NMFQ..KMR.V.V.DFKGKVL.DI.E.WM....GEM
Retrocopy
MSKSKEPVSSNSSSSNSDSEVDK/KVK/RGKSKLLQKNL*RSKTGETSRALSSTEQSSN/QKQYNMFQTQKMR*VHVKDFKGKVLTDIKEHWMYQK/GEM


Parental protein
KPGRKGISLNPEQWSQLK-EQISDIDDAVRK
KP.RKGI.L..EQWSQLK.E.ISDI.D....
Retrocopy
KPERKGIPLISEQWSQLK/EKISDINDKAKE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide