RetrogeneDB ID:
retro_mputfur_305
Organism:
Location:
GL896902.1:19831044-19831356 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
61.4 %
Coverage:
97.37 %
Frameshifts:
3
Stop codons:
0


Parental gene:
Parental gene symbol:
POLE4
Parental gene aliases:
No gene alias available
Parental gene description:
polymerase (DNA-directed), epsilon 4, accessory subunit [Source:HGNC Symbol;Acc:18755]

Genomic region (view in browser)





>retro_mputfur_305
GCCAAGGGGGGTGCAGGGGGAGCCCAGGAGGAGGGGCCCAGGGGAAAGCCTGGAGCCCCA
AACCCAGTGAGAGTAGCTATCAGGCTGGTAGCTGCAGGCTGCCTCTGGCAAGAGTTAAAG
TGCTGGTGGAGGCAGACCCAACGTAACCCTTGAGGGACAGGAAGCCATCTTCATTCTCAC
ACAAGCCTGGGAGACCATTGCAAAAGTGCCTACTGCTGTGTGCAGCAAGGAAAGAGGAAA
ACCCTCCAGGGGGGAGATTCGGATAATGCACTAGAAGCTGTGGATAAATTTGCTTTTCTG
GAAGGAACTTTG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AAGSGTPLEEEGPSGEAAA-PQPQAPTSAPGARLSRLPLARVKALVKAD-PDVTLAGQEAIFILARAAELFVETIAK-DAYCCAQQGKRKTLQRRDLDNA
A.G......EEGP.G...A.P.P.......G....RLPLARVK.LV.AD.P.VTL.GQEAIFIL..A.E....TIAK..AYCC.QQGKRKTLQ..D.DNA
Retrocopy
AKGGAGGAQEEGPRGKPGA/PKPSESSYQAGS--CRLPLARVKVLVEAD/PNVTLEGQEAIFILTQAWE----TIAK/SAYCCVQQGKRKTLQGGDSDNA


Parental protein
IEAVDEFAFLEGTL
.EAVD.FAFLEGTL
Retrocopy
LEAVDKFAFLEGTL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide