RetrogeneDB ID:
retro_mputfur_312
Organism:
Location:
GL896903.1:1057525-1058433 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
72.22 %
Coverage:
100.0 %
Frameshifts:
3
Stop codons:
2


Parental gene:
Parental gene symbol:
MTCH2
Parental gene aliases:
No gene alias available
Parental gene description:
mitochondrial carrier 2 [Source:HGNC Symbol;Acc:17587]

Genomic region (view in browser)





>retro_mputfur_312
ATGGCAGTCATTGCTAGTCACATGCTCCTGGTCTCCGGTCTCACCTTTGTGTTCCAGACA
CTCATGTCTATGAAAGTACTCATCCAGGTAGAAAATGAGCCTCTTCCTCCAACAAAAGGA
CAAAATATTTTTGGGCAACAAGTATGTCAGCTCCCTGGTCTGTTTTGTTATGCTCAGCAT
TTTGTCAGCATTAGTGGGAAACATGGGTTGTTCATAGACTTAACTCCAAAACTATGTTCA
GGAATCCTTGGAATTGTGGTCCATGGTAACATTTTACAGCTTTATTGGGTAGTGTGAGAA
TGTTGAGGAAATAGGCCCTGAAAATGTGCAAAAAGAAGCCATATTTTTCTTCAACCAAGT
TATCAAGGAGACAAATCAAGAGACGATGGCTTGTTCTGCTGCTACCCTCATCACACATCC
CTTCCACATGATCACTCTGAGATTTGTGGTACAATTCACTGGCAGAGAATCCAAGTACTG
TGGACTTTGTGACTCTGTTGTAACTATGTATCAGGAAGAGGGCATCCTAGGATTTTTGTG
GGTCTTATTCTTCACCTCCAAGGTGACATAATTTCTTTGTGGCTCTGAAACTCACCAGCC
TACCTTGACAGTACCTATGCACTGGACAGTGAGGTTTCCACCATGTATGAAATGAAGAGT
TATTCTGGAGCTGTCATAGGATTTTTTTGCCAATGTTGACCTACCCCTTTGTGCTTATTT
CTAATCTTATGGTTGTCAACAACTGTGGGCTTACTGGTGGATCCCCACCTTACTTCACAA
TATATACTTCTTGGATAGATTGCTGGTGCCTTCTACAAAAAGAGAGAAATATGGGCTGAG
AAAATAATTTCTTTTTCCAGAAGGTCCCCTTTGGGAAGACTTATTGTTGTGACCTGAGGA
TGTTAATT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQLPGLFCYAQHIASIDGKRGLFTGLTPRLCSGVLGTVVHGKVLQHYQE-CD
MA..AS..LL.SGLT...Q.LM..KVLIQV..EPLPPT.G.NIFG.QVCQLPGLFCYAQH..SI.GK.GLF..LTP.LCSG.LG.VVHG..LQ.Y...C.
Retrocopy
MAVIASHMLLVSGLTFVFQTLMSMKVLIQVENEPLPPTKGQNIFGQQVCQLPGLFCYAQHFVSISGKHGLFIDLTPKLCSGILGIVVHGNILQLYWV\CE


Parental protein
KVEDLGSGNSQKEVTPSFDQVIKETTREMMARSAATLITHPFHVITLRSMVQFIGRESKYCGLYDSIVTIYREEGILGF-FAGLIPRLLGDIISLWLCNS
.VE..G..N.QKE....F.QVIKET..E.MA.SAATLITHPFH.ITLR..VQF.GRESKYCGL.DS.VT.Y.EEGILGF.F.GLI..L.GDIISLWL.NS
Retrocopy
NVEEIGPENVQKEAIFFFNQVIKETNQETMACSAATLITHPFHMITLRFVVQFTGRESKYCGLCDSVVTMYQEEGILGF/FVGLILHLQGDIISLWL*NS


Parental protein
LAYLVNTYALDSGVSTMSEMKSYSQAVTGFFAS-MLTYPFVLVSNLMAVNNCGLAGGCPPYSPIYTSWIDCWCMLQKEGNMSRGNSLFFRKVPFGKTYCC
.AYL..TYALDS.VSTM.EMKSYS.AV.GFF...MLTYPFVL.SNLM.VNNCGL.GG.PPY..IYTSWIDCWC.LQKE.NM...N..FF.KVPFGKTYCC
Retrocopy
PAYLDSTYALDSEVSTMYEMKSYSGAVIGFFCQ/MLTYPFVLISNLMVVNNCGLTGGSPPYFTIYTSWIDCWCLLQKERNMG*ENNFFFQKVPFGKTYCC


Parental protein
DLRMLI
DLRMLI
Retrocopy
DLRMLI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide