RetrogeneDB ID:
retro_mputfur_318
Organism:
Location:
GL896903.1:12376163-12376670 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
73.3 %
Coverage:
100.0 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
TIMM17A
Parental gene aliases:
No gene alias available
Parental gene description:
translocase of inner mitochondrial membrane 17 homolog A (yeast) [Source:HGNC Symbol;Acc:17315]

Genomic region (view in browser)





>retro_mputfur_318
ATGGAGGAATATATGTGAGAGCCTTGTCCTCGCGAATTGTGGATGACTGTGGGGGGGCTC
TTTATCAGGGATACCACAGTTGGTGGTATCTTTCAATCACTCAAAGGTTTTCACAATTCT
CCAGTGGAAGTAAACCACAGACTACAAGGGAGTTTCACAGCTATTAAAACCGGGGCTCCA
CAGTTGAGAGGTAGCTTTGCAGTTTGTGGAGGTTTATTTTTCATGACTGACTGCATTATG
GTTCAAGCCAGAAGGAAAGATTCCTGGAACTCCATCACAAGTGTTGCCTTAACAGGAGCC
ATACTGTCAGCAAGAGATGGATCAGTGGCCATCGTTGGGTCCGCAGTGATGGGTGGCATT
CTAGTTTTAATTATAGGACCTGGTATCTTGTTGATAAGATTTATCTCTGCATGATTTCCC
AATGGTCCTCAGTTTGCTAAAGACCCCTCTCAGTTGCCTTCTGCCCAGTTACCATCCTCA
CCTTTTGGAGACAATCGACAATATCAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MEEYAREPCPW-RIVDDCGGAFTMG-TIGGGVFQAIKGFRNSPVGVNHRLRGSLTAIKTRAPQLGDKTGSFAVWGGLFSMIDCSMVQVRGKEDPWNSITS
MEEY..EPCP..RIVDDCGGA...G.T..GG.FQ..KGF.NSPV.VNHRL.GS.TAIKT.APQL....GSFAV.GGLF.M.DC.MVQ.R.K.D.WNSITS
Retrocopy
MEEYM*EPCPR/RIVDDCGGALYQG\TTVGGIFQSLKGFHNSPVEVNHRLQGSFTAIKTGAPQL---RGSFAVCGGLFFMTDCIMVQARRK-DSWNSITS


Parental protein
GALTGAILAARNGPVAMVGSAAMGGILLALIEGAGILLTRFASAQFPNGPQFTEDPSQLPSAQLPSSPFGDYRQYQ
.ALTGAIL.AR.G.VA.VGSA.MGGIL...I.G.GILL.RF.SA.FPNGPQF..DPSQLPSAQLPSSPFGD.RQYQ
Retrocopy
VALTGAILSARDGSVAIVGSAVMGGILVLII-GPGILLIRFISA*FPNGPQFAKDPSQLPSAQLPSSPFGDNRQYQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide