RetrogeneDB ID:
retro_mputfur_319
Organism:
Location:
GL896903.1:12638072-12638401 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
62.39 %
Coverage:
73.72 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
RPS27A
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S27a [Source:HGNC Symbol;Acc:10417]

Genomic region (view in browser)





>retro_mputfur_319
ATGCAGATTTTTGTGAAAACCTTTACAGGGAAGACCATCACTCTTGAGGTTGAATCCTCA
GAGTAGAAAACATAAAGGCCAAGATCCAGGAATTCCTCCTGATCAGCAGAAACTGATCTT
TGCTGGCAAGCAACTGGAAGGTGGATGGACTTTGTGTGACTACAGCATTCAAAAGGAGGC
CCCTCTTCATCTTGTGTTGAAACTTCGTGGTGGGTCTAGAAAGAAGGAAGGAGTCTTGCA
GCACTCCCAAGGAGAATAAGCGTAAGAGAAAGAAGGTTAAGCCAGCTGTCCTGAAATACC
AGAAGGTGAATGAGAATGAACCAGTCACC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MQIFVKTLT-GKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKK-RKKKSYTTPKKNKHKRKKV
MQIFVKT.T.G....L...P.......K.K.QD..GIPPDQQ.LIFAGKQLE.G.TL.DY.IQKE..LHLVL.LRGG..K.RK..S..TPK.NK.KRKKV
Retrocopy
MQIFVKTFT\GRPSLLRLNP----QSRKHKGQDP-GIPPDQQKLIFAGKQLEGGWTLCDYSIQKEAPLHLVLKLRGGSRK\RKE-SCSTPKENKRKRKKV


Parental protein
KLAVLKYYKVDENGKIS
K.AVLKY.KV.EN....
Retrocopy
KPAVLKYQKVNENEPVT


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide