RetrogeneDB ID:
retro_mputfur_321
Organism:
Location:
GL896903.1:17308919-17309309 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
52.52 %
Coverage:
75.28 %
Frameshifts:
4
Stop codons:
0


Parental gene:
Parental gene symbol:
NAA20
Parental gene aliases:
No gene alias available
Parental gene description:
N(alpha)-acetyltransferase 20, NatB catalytic subunit [Source:HGNC Symbol;Acc:15908]

Genomic region (view in browser)





>retro_mputfur_321
TATTTCATAGCTACGGCCGCACTTGGTGGCGGGCGTTTGGGTTACATGATGGGTAAACCA
GTCTCCGTAGCTGTGGAAGATGGTACATGTACATCACAGCCTTTTCTGTTGTTCTAGAAT
TTCTGTGCCTTGGTTTCCCTGCTAAACTAATGGAATTAATTAGAGGATGTTTCAAAAGAA
AGGGGTGGTTCTTTTTAATTGATCTCTTTGTAAGAGCTTCTAATCAAATTGCAGCCACAT
GTATAAGCAACTGATCTGGAAGCGTGCACATGACCATCACTGCCTACTACTTCTCCTGCA
GCGAAGATGCTTGCCGTATGAGAAAAGCATCTCCCAGGGACACAGAGAAGAGATCCAGCA
CACCACCTGCCTCACCCTGGGAGCCCTCAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
YFIVAEAPGGELMGYIMGKAEGSVAREE-WHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFF-VDLFVRVSNQVAV-NMYKQLGY-SVYRTVIEY
YFI...A.GG...GY.MGK...SVA.E..W....TA.SV..EF..LG..AKLMEL......RKG.FF..DLFVR.SNQ.A...MYKQL...SV..T...Y
Retrocopy
YFIATAALGGGRLGYMMGKPV-SVAVED/WYMYITAFSVVLEFLCLGFPAKLMELIRGCFKRKGWFFLIDLFVRASNQIAA/HMYKQLIW\SVHMTITAY


Parental protein
YSASNGEPDEDAYDMRKALSRDTEKKSIIP-LPHPVRPE
Y........EDA..MRKA..RDTEK.S..P.LPHP..P.
Retrocopy
YFSCS----EDACRMRKASPRDTEKRSSTP\LPHPGSPQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide