RetrogeneDB ID:
retro_mputfur_323
Organism:
Location:
GL896903.1:19952411-19952702 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
83.17 %
Coverage:
99.01 %
Frameshifts:
0
Stop codons:
2


Parental gene:
Parental gene symbol:
ENY2
Parental gene aliases:
No gene alias available
Parental gene description:
enhancer of yellow 2 homolog (Drosophila) [Source:HGNC Symbol;Acc:24449]

Genomic region (view in browser)





>retro_mputfur_323
GTGGTTAGCAAGATGAACAAAGATGCGCAGATGAGCGCAGCGATTGACCAAAAGTTGATA
GAAACTGGAGAAAGAGAACGCCTCAACGAGTTGCTGAGAGCTAAATTAACTGAATGTGGC
TGAAAGACACATTAGTGGAAGGCACACTGTAAAGAGGTAATTAAAGAAAAGGGTCTATTG
ATGACTTCGGTGGCTGAAATCACACCAAAAGGCAGAGCCCTGGTACCTGACAGTGTAAAG
AAGGAGCTCCTACAAAGAATAAGAACATTCCTTGCTCAGCATGCCAGCCTT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VVSKMNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQ-LKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQHAS
VVSKMNKDAQM.AAI.QKLIETGERERL.ELLRAKL.ECG.K....KAHCKEVIKEKGL....V....AEITPKGRALVPDSVKKELLQRIRTFLAQHAS
Retrocopy
VVSKMNKDAQMSAAIDQKLIETGERERLNELLRAKLTECG*KTH*WKAHCKEVIKEKGLLMTSV----AEITPKGRALVPDSVKKELLQRIRTFLAQHAS


Parental protein
L
L
Retrocopy
L


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide