RetrogeneDB ID:
retro_mputfur_324
Organism:
Location:
GL896903.1:21299691-21300032 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
82.61 %
Coverage:
54.85 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
BTF3
Parental gene aliases:
No gene alias available
Parental gene description:
basic transcription factor 3 [Source:HGNC Symbol;Acc:1125]

Genomic region (view in browser)





>retro_mputfur_324
AAGATGAAAGAAACTATCATGAACCAGGAGAAACTCACCAAACTGCAAGCACAAGTGTGC
ATTGGTGGGAAAGGAACTGCTCACCGAAAGAAGAAGGTGGTTCATAGAACAGCTACAGCA
GATGATAAAAAAAACTTCAGTTCTCCTTAAAGAAGTTAGGGGTAAACAATATCTCTGGTA
TTGAAGAAGTGAATATGTTCACAAACCAAGGAACAGTGATCCACTTTAACAACCCCAAAG
TTCAGGCATCGCTGGCAGCGAACCCTTTCATCATTACAGGCCATGCTGAGACAAAGCAGC
TGACAGAAATGCTACCCAGTATCTTAAACCAACGTGGTGCA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QMKETIMNQEKLAKLQAQVRIGGKGTA-RRKKKVVHRTATADDKK-LQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETK
.MKETIMNQEKL.KLQAQV.IGGKGTA.R.KK.V.......D....LQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAAN.F.ITGHAETK
Retrocopy
KMKETIMNQEKLTKLQAQVCIGGKGTAHRKKKVVHRTATADDXXX/LQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANPFIITGHAETK


Parental protein
QLTEMLPSILNQLGA
QLTEMLPSILNQ.GA
Retrocopy
QLTEMLPSILNQRGA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide