RetrogeneDB ID:
retro_mputfur_326
Organism:
Location:
GL896903.1:31285762-31286011 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
70.59 %
Coverage:
96.59 %
Frameshifts:
0
Stop codons:
2


Parental gene:
Parental gene symbol:
SEPW1
Parental gene aliases:
No gene alias available
Parental gene description:
selenoprotein W, 1 [Source:HGNC Symbol;Acc:10752]

Genomic region (view in browser)





>retro_mputfur_326
ATGGCCCTCACCAACCAAATCATTTATTGTGGTGCTTGAGGCTACAAGTCCAAGAATCTT
CAGTTCAAGAAGTTGGAAGATGAGGTCCCCAGATGCCTGGACGTCTATGGTGAAGGGATT
CCATAGGCCACTGGCTTCTTCGAAGTGATGGTAGCGGTGACGTTGGTTCACTCCAAGAAG
AGAGGTAATGGCTACATAGACATGGAGAGCAAGTTTCTGAAGCTGGTGGCCTCCATCCAA
GCTGCTTTG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MALAIRVVYCRARGSYKSKYLQLKKKLEDEFPGCLDICGEGTPQATGFFEVMVAGKLVHSKKRGDGYVDTESKFLKLVAAVKAAL
MAL.....YC.A.G.YKSK.LQ.KK.LEDE.P.CLD..GEG.P.ATGFFEVMVA..LVHSKKRG.GY.D.ESKFLKLVA...AAL
Retrocopy
MALTNQIIYCGA*G-YKSKNLQFKK-LEDEVPRCLDVYGEGIP*ATGFFEVMVAVTLVHSKKRGNGYIDMESKFLKLVASIQAAL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide