RetrogeneDB ID:
retro_mputfur_33
Organism:
Location:
GL897042.1:645132-645435 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
78.35 %
Coverage:
75.78 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
SUMO1
Parental gene aliases:
No gene alias available
Parental gene description:
small ubiquitin-like modifier 1 [Source:HGNC Symbol;Acc:12502]

Genomic region (view in browser)





>retro_mputfur_33
GATGACCTGGAGGCAAACCCTTCAAATGAGGATGTGGACAAGAAGAAGCCAGAAGAACAC
ATTAAACTCAAAGTCATCAGACAGGATAGCAGTGAGATACATTTCAGAGTGAAAATGACA
ACACGTATGAAAAAACTCAAAGAACGCTACTGTCAAAGACAAGGAGTTTCAATGCACTCA
CTTCGATTTCTGTTTGATGGTAAGAGAATTGCTGACAACCACACCGCCAAAGAGCTAGGA
ATGGAGGAAGATGATGTAATTGAAGTTTATCAGGAACAAAACGGGGGTCATTCAATGATT
TAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
EAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTI
EA.PS.ED...KK..E.IKLKVI.QDSSEIHF.VKMTT..KKLKE.YCQRQGV.M.SLRFLF.G.RIADNHT.KELGMEE.DVIEVYQEQ.GGHS.I
Retrocopy
EANPSNEDVDKKKPEEHIKLKVIRQDSSEIHFRVKMTTRMKKLKERYCQRQGVSMHSLRFLFDGKRIADNHTAKELGMEEDDVIEVYQEQNGGHSMI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide