RetrogeneDB ID:
retro_mputfur_330
Organism:
Location:
GL896903.1:15305666-15306103 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
63.09 %
Coverage:
56.32 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
PCNA
Parental gene aliases:
No gene alias available
Parental gene description:
proliferating cell nuclear antigen [Source:HGNC Symbol;Acc:8729]

Genomic region (view in browser)





>retro_mputfur_330
GAAATGAAGTTGATGGCTTTAGATGTGGAACACCTTGGAATTCAAGAACAGGCCATAGCT
AGCTGTGCAGTAAAGAGGCCGTCAGGTGAATTTGCACTTATTTGTCCAGATCTCGGTCAT
ATTGGAGATGCTGTTGTGATTTCCTGTGCAAGAGAGGGAAGGAAATTTTCTGCAAGTGGA
GTATTAGGAAATGGAAATATCACATTGTCATAAGTAATGTCGGTAAAGAAGAGGAAGCTG
TTACCATAGAGATGAGCAAGCCATTAGGGCTAACTTTCGCCTTGATAACCGAACTTTTTT
AGGAAAGCCACTCCACTCTCTCCTATAGGAACACTCAGTATGTGCGCAGATGGATCCCTT
GTGTAGGGTATAAACTTGCTGATATTGGACATTTAAAGTACTATTTGGCTTCCAAGATCG
AGGATGAATTGGGAACG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
EMKLMDLDVEQLGIPEQEY-SCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDK-EEEAVTIEMNEPVQLTFALRYL
EMKLM.LDVE.LGI.EQ...SC.VK.PSGEFA.IC.DL.HIGDAVVISCA..G.KFSASG.LGNGNI.LS....V.K.EE.AVTIEM..P..LTFAL...
Retrocopy
EMKLMALDVEHLGIQEQAIASCAVKRPSGEFALICPDLGHIGDAVVISCAREGRKFSASGVLGNGNITLS*VMSVKK/EE-AVTIEMSKPLGLTFALITE


Parental protein
NFFTKATPLSPTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
.F......LS...T.......P..V.YK.AD.GHLKYYLA.KIEDE.G.
Retrocopy
LF*ESHSTLSYRNTQYVRRWIP-CVGYKLADIGHLKYYLASKIEDELGT


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide