RetrogeneDB ID:
retro_mputfur_332
Organism:
Location:
GL896903.1:22894755-22895069 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
59.81 %
Coverage:
67.95 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
RPS27A
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S27a [Source:HGNC Symbol;Acc:10417]

Genomic region (view in browser)





>retro_mputfur_332
ATGCAGATTTTCATGAAAACCCTTATGGGAAAGACCATCACCCTTGAGGCTGAACCCTCA
AATACATTAGAAAATACAAAGGCGGAGAACCAGGAGAAGGAAGGAATTCTCCCAATCGGC
AGAGGCTGATTCTCACCGGCAAGCACCTGGAGGGTGGACATACTATGTCTGACTATGATG
TTCGAAAGGAGTCCACTCTTCATCTTATGTTGAGACTTTGTGGTGGCACAAAGAAAAGAC
AGAAGTCTGAGACCACGCCCAAGAAGAATAAGCATAAGAGAAAGAAGATTAAGCCAGCCA
TCCTGAAATACTAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGI-PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVK
MQIF.KTL.GKTITLE.EPS.T.EN.KA..Q.KEGI..P..Q.....................KESTLHL.LRL.GG.KKR.K.S.TTPKKNKHKRKK.K
Retrocopy
MQIFMKTLMGKTITLEAEPSNTLENTKAENQEKEGI/SPNRQXXXXXXXXXXXXXXXXXXDVRKESTLHLMLRLCGGTKKRQK-SETTPKKNKHKRKKIK


Parental protein
LAVLKYY
.A.LKYY
Retrocopy
PAILKYY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide