RetrogeneDB ID:
retro_mputfur_334
Organism:
Location:
GL896903.1:31207237-31207856 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
86.19 %
Coverage:
100.0 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
RPS8
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S8 [Source:HGNC Symbol;Acc:10441]

Genomic region (view in browser)





>retro_mputfur_334
ATGGGCATCTCTCGGGACAACTGGCGCAAGCGCCACAAGACCGGGGGCAAGAGAAAGCCC
CACCACAAGAAGCGGAAGTACGGCCTGGGACGCCCCACTGCCAACAGCAAGATCGGTCCC
CGCTGCATACACACGTCGGAGTCCAGGGAGGCAATAAGAAGTACTGTGCCTTGAGGCTAG
ACATGGGGAACTTCTCCTGGGGCTCTGAGTATTGTCCGCACAAAACGAGGATTATTGATG
TTGTCTACAATGCAGCCAGCAACGAACTGGTCCGCACCAAGACCCTGGCGAAGAACTGTA
TTGAGCTCATTGACAGCAGACCGTACCGACAGTGGTACGGGTCCCACTATGCACTGCCCC
TGGGCCGCAAGAAGGGGGCCAAGCTGACGCCTGAGGAGGAAGAGATTTTAAATAAAAACG
ATCAAAGAAAATTCAGAAGTATGATGAAAGGAAGACAAATGCCAAAATCAGCAGTCTTCT
GGAGGAGCAATTGCAGCAGGGCAAGCTTCTTGCGTGCATCGCTTCACCACCAGGCCAGTG
TGGCCGAGCAGATGGCTACGTCCTAGAGGTCAAGGAGCTAGAGTTCTAGCTGAGGAAAAT
CAAAGCCCGGAAAGGCAAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VGISRDNWHKRRKTGGKRKPYHKKRKYELGRPAANTKIGPRRIHT-VRVRGGNKKYRALRLDVGNFSWGSECCTRKTRIIDVVYNASNNELVRTKTLVKN
.GISRDNW.KR.KTGGKRKP.HKKRKY.LGRP.AN.KIGPR.IHT.V.V.GGNKKY.ALRLD.GNFSWGSE.C..KTRIIDVVYNA..NELVRTKTL.KN
Retrocopy
MGISRDNWRKRHKTGGKRKPHHKKRKYGLGRPTANSKIGPRCIHT/VGVQGGNKKYCALRLDMGNFSWGSEYCPHKTRIIDVVYNAASNELVRTKTLAKN


Parental protein
CIVLIDSTPYRQWYESHYALPLGRKKGAKLTPEEEEILNK-KRSKKIQKKYDERKKNAKISSLLEEQFQQGKLLACIASRPGQCGRADGYVLEGKELEFY
CI.LIDS.PYRQWY.SHYALPLGRKKGAKLTPEEEEILNK.KRSKKIQ.KYDERK.NAKISSLLEEQ.QQGKLLACIAS.PGQCGRADGYVLE.KELEF.
Retrocopy
CIELIDSRPYRQWYGSHYALPLGRKKGAKLTPEEEEILNK/KRSKKIQ-KYDERKTNAKISSLLEEQLQQGKLLACIASPPGQCGRADGYVLEVKELEF*


Parental protein
LRKIKARKGK
LRKIKARKGK
Retrocopy
LRKIKARKGK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide