RetrogeneDB ID:
retro_mputfur_336
Organism:
Location:
GL896904.1:8459786-8460247 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
69.18 %
Coverage:
81.05 %
Frameshifts:
5
Stop codons:
3


Parental gene:
Parental gene symbol:
LZIC
Parental gene aliases:
No gene alias available
Parental gene description:
leucine zipper and CTNNBIP1 domain containing [Source:HGNC Symbol;Acc:17497]

Genomic region (view in browser)





>retro_mputfur_336
GAGACCAGAGAGGAACTTGATGTATATGAATAGGAAGAAACCAATAAAGGAAACTCGGGA
GCAACTAAGCCACTTTAATGATGTCACTGAAGAAAATCATGTCTGGAAATATGACTCCAG
TAGACGAGCCAAGTGGAATGCAACTGCCATCCAGGCGGCTGTCAGCCAGGCCATTAAGAC
CCCACACATCATCTGATTACTTGCAGAGAAATGGTCGGGTCGGTTCCAGACAAGGTGAGT
GGAGATGGATGGAGATCTCATGGTAGAGAAGATGGAAAGAGACCTGAACGCCCAACAGAA
AGTGGAGATACTAAGTGCTCTCAGGACACTTGGAGAAAAGCTGACTGCGATCATGAGGCC
CTCTTATCAGCAAACACAAGTCTCCCCTCAGCCAGTCTGAGAAAGTCTCTACAGACCTTG
GCTCTGGAGGCAAACTTCTGGCACTGACAAGTTCTGATGTT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ECREELDTDEYEETKK-ETLEQLSEFND-SLKKIMSGNMTLVDELSGMQL-AIQAAISQAFKTPEVIRLFAKKQPGQLRTRLAEMDRDLMVGKLDRGLYM
E.REELD..E.EET.K.ET.EQLS.FND.SLKKIMSGNMT.VDE.SGMQL.AIQAA.SQA.KTP..I.L.A.K..G...TR..EMD.DLMV.K..R.L..
Retrocopy
ETREELDVYE*EETNK\ETREQLSHFND\SLKKIMSGNMTPVDEPSGMQL/AIQAAVSQAIKTPHII*LLAEKWSGRFQTR*VEMDGDLMVEKMERDLNA


Parental protein
QQKVEILTALRKLGEKLTA-DDEAFLSANAG-AILSQFEKVSTDLGSGDKVLALASFEV
QQKVEIL.ALR.LGEKLTA.D.EA.LSAN.....LSQ.EKVSTDLGSG.K.LAL.S..V
Retrocopy
QQKVEILSALRTLGEKLTA/DHEALLSANTS/SPLSQSEKVSTDLGSGGKLLALTSSDV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide