RetrogeneDB ID:
retro_mputfur_337
Organism:
Location:
GL896904.1:11752373-11752884 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
67.24 %
Coverage:
80.77 %
Frameshifts:
3
Stop codons:
3


Parental gene:
Parental gene symbol:
RPS8
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S8 [Source:HGNC Symbol;Acc:10441]

Genomic region (view in browser)





>retro_mputfur_337
CTAGGCATTTCTCAGGGCAATCGGCCTAAGTGCCACAAGACCAGGGGCAAAAGAAAGCCC
TGCCATGAGAACAGAAAGTGGGAGCTGGGACACCCCGCTGCCATACTAAGGCTGGCCCCC
ACCACGCACACACAGCCGGCGTTAGGGGGAGACAGTAAGAAGCGCCGTGCCTTGAGGCTG
GACGTGAGCAACTTCTCCTGGGGCTCTGAGTGTTGAGCCCGGCAAAACAAGGAGTACTGA
TGCTGTTGACAATGCATCTGCCAACGACCTGGTCAGCACCAAGCCCCTGGTGAAGAATGG
CATCATGCTCACAGATGGCACACCTCCCACACCTTGCAGATAGTGGCAGGAGTCCCACCA
TGCACTGCCCCTGGGCCGCAAGAAGGAGGCCTAGCTGACTCTGGAGAAGGAAGAAATTTT
AAACAAAAAACAATCAAGGAAAACTAAGAAATATGATGAAAGGAAGAAGAATGCTAAAAT
TAGCAGTCTTCTGGAGGGGCAGTTCCAGCAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VGISRDNWHKRRKTGGKRKPYHKKRKYELGRPAA-NTKIGPRRIHTVRVRG-GNKKYRALRLDVGNFSWGSECCTR-KTRIIDVVYNASNNELVRTKTLV
.GIS..N..K..KT.GKRKP.H..RK.ELG.PAA..TK.GP...HT..VRG...KK.RALRLDV.NFSWGSEC..R.KTR..D.V.NAS.N.LV.TK.LV
Retrocopy
LGISQGNRPKCHKTRGKRKPCHENRKWELGHPAA/HTKAGPHHAHTAGVRG\DSKKRRALRLDVSNFSWGSEC*AR\KTRSTDAVDNASANDLVSTKPLV


Parental protein
KNCIVLIDSTP---YRQWYESHYALPLGRKKGAKLTPEEEEILNKKRSKKIQKKYDERKKNAKISSLLEEQFQQ
KN.I.L.D.TP....R.W.ESH.ALPLGRKK.A.LT.E.EEILNKK.S.K..KKYDERKKNAKISSLLE.QFQQ
Retrocopy
KNGIMLTDGTPPTPCR*WQESHHALPLGRKKEA*LTLEKEEILNKKQSRK-TKKYDERKKNAKISSLLEGQFQQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide