RetrogeneDB ID:
retro_mputfur_339
Organism:
Location:
GL896904.1:14205400-14206183 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
66.42 %
Coverage:
72.21 %
Frameshifts:
6
Stop codons:
1


Parental gene:
Parental gene symbol:
DRG1
Parental gene aliases:
No gene alias available
Parental gene description:
developmentally regulated GTP binding protein 1 [Source:HGNC Symbol;Acc:3029]

Genomic region (view in browser)





>retro_mputfur_339
GGGTTTGTGGATTTTCCATCTGTGGAGAAGTCAACACGGCTCAGTGACTGGCAGCGGTAT
ATTTCAGTATGAAGCCTGAGTTCACCACTCTCGCCACAGTTCCTGGTGTCATCACATACA
AAGGTGCCAAGACCCAGCTTCTGGATCTCCCAGTTATCCATGAGGGTGCCAAGAATGAAA
AAAAGTAAAGGAAGTCATTGTAGTGGCCTGGGTGTGTGACCTGATCGCGATTGCTCTGGA
TGTCCTGAAGCCACTGGGACATGAGAAGATCACTGAATACAAGCTGGGACGCTTTAGAAT
TCACTTGAACAGCAAGCCCCTCAACATTGGCTTTAAGAAGGAGGTAAGGAAAGCATCGAT
CTCACTGTCACTTGCCCTCAAAGTGAGCTGGATGCTCAAATTGTGCGGAACATTCCGGCT
GAATATAAAATTAGTAATGCCGGTGTGGCTCTGACAGTGATGCCACAGTACATGACTTCA
TTGACATGGTGGAAGGAAATAGAGTCTCTATCCTTTGTATCTATGTGTTAAATAAGATCT
ATCAGATCTCCATTGAAGAATTGTATATCATCTATAAAGTGCCTCACTATGCATTTATCT
CTGCCTATCACTGCTGGAATTTTGGTGACCTGTTGGAAAATATATGGTACTTAGAAAAAC
TAGTGAGGCTTTCACCAAGCCCAAAGCGCAGTTGCCAGATTACACACCTCCAATAGTGCC
ACCTTACCCCAGGATCACATGGAGGATTTCCACACAAATATTCACAAGAATCTTATCAAA
GAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GFVGFPSVGKSTLLSN-LAGVYSEVAAYEFTTLTTVPGVIRYKGAKIQLLDLPGIIE-GAKDGKGRGRQVIAVARTCNLILIVLDVLKPLGHKKIIENEL
GFV.FPSV.KST.LS..LA.VY......EFTTL.TVPGVI.YKGAK.QLLDLP.I.E.G....K.....VI.VA..C.LI.I.LDVLKPLGH.KI.E..L
Retrocopy
GFVDFPSVEKSTRLSD/LAAVYFSMKP-EFTTLATVPGVITYKGAKTQLLDLPVIHE/GCQE*K-KVKEVIVVAWVCDLIAIALDVLKPLGHEKITEYKL


Parental protein
EGFGIRLNSKPPNIGFKKK-DKGGINLTATCPQSELDAETVKSILAEYKIHNADVTLR-SDATADDLIDVVEGNRVYIPCIYVLNKIDQISIEELDIIYK
..F.I.LNSKP.NIGFKK...K..I.LT.TCPQSELDA..V..I.AEYKI.NA.V.L..SDAT..D.ID.VEGNRV.I.CIYVLNKI.QISIEEL.IIYK
Retrocopy
GRFRIHLNSKPLNIGFKKE/GKESIDLTVTCPQSELDAQIVRNIPAEYKISNAGVALT/SDATVHDFIDMVEGNRVSILCIYVLNKIYQISIEELYIIYK


Parental protein
VPHCVPISAHHRWNFDDLLEKIWDYLKLVRI-YTKPKGQLPDYTSPVVLPYSRTT-VEDFCMKIHKNLIKE
VPH...ISA.H.WNF.DLLE.IW...KLVR...TKPK.QLPDYT.P.V.PY.R.T..EDF...IHKNLIKE
Retrocopy
VPHYAFISAYHCWNFGDLLENIWYLEKLVRL/FTKPKAQLPDYTPPIVPPYPRIT/MEDFHTNIHKNLIKE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide