RetrogeneDB ID:
retro_mputfur_340
Organism:
Location:
GL896904.1:15922532-15923141 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
52.15 %
Coverage:
63.33 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
RNF128
Parental gene aliases:
No gene alias available
Parental gene description:
ring finger protein 128, E3 ubiquitin protein ligase [Source:HGNC Symbol;Acc:21153]

Genomic region (view in browser)





>retro_mputfur_340
TCTTGGCTGGCCCTCATCGAACGGGGAGGCTGTACTTTTACACATAAGATCAATGTGGCA
GCAGAGAAGGGAGCAAATGGGGTGATCATCTATAACTATCCAGGTACAGGCAACAAAGTG
TTTCCTATGTCTCATCAGGGAACAGAAAACATAGTTGCTGTGATGATAGGCAACTTGAAA
GGCATGGAACTTTTGCACTTGATTCAGAAGGGAGTCTATGTGACAATCATCATCGAAGTG
GGGAGAATGCATCTGCCATGGCTGAGCCATTATATCATGTCTCTGTTCACCTTCCTGGCT
GCCACAGTTGCCTACCTTTTCTTGTACTGTGCGTGGAGACCTAGGGTGCCCAATTCTTCC
ACCAGGAGGCGAAGACAGATAAAAGCAGATGTGAAGAAAGCTATTGGTCAGCTTCAACTG
CGCGTGCTCAAAGAAGGGGATAAGGAACTAGATCCAGATGAAGACAGTTGTGTTGTTTGC
TTTGACATTTACAAACCCCAAGATGTAGTACGTATTTTAACTTGCAAACATTTTTTCCAT
AAGGCATGCATTGACCCCTGGCTTTTAGCCCATAGGACATGCCCCATGTGCAAGTGTGAT
ATTTTGAAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SWLALIQRGGGCTFADKIHLAYERGASGAVIFNFPGTRNEVIPMSHPGAGDIVAIMIGNLKGTKILQSIQRGIQVTMVIEVGKKHGPWVNHYSIFFVSVS
SWLALI.RGG.CTF..KI..A.E.GA.G..I.N.PGT.N.V.PMSH.G...IVA.MIGNLKG...L..IQ.G..VT..IEVG..H.PW..HY........
Retrocopy
SWLALIERGG-CTFTHKINVAAEKGANGVIIYNYPGTGNKVFPMSHQGTENIVAVMIGNLKGMELLHLIQKGVYVTIIIEVGRMHLPWLSHYIMSL--FT


Parental protein
FFIITAATVGYFIFYSARRLRNARAQSRKQKKLTLSLIFTYSSCQLGVFLLGIEEIGPDGDSCAVCIELYKPNDLVRILTCNHIFHKTCVDPWLLEHRTC
F...T.A..........R...N.....R.Q.K............QL.V...G..E..PD.DSC.VC...YKP.D.VRILTC.H.FHK.C.DPWLL.HRTC
Retrocopy
FLAATVAYLFLYCAWRPR-VPNSSTRRRRQIKADVKK--AIGQLQLRVLKEGDKELDPDEDSCVVCFDIYKPQDVVRILTCKHFFHKACIDPWLLAHRTC


Parental protein
PMCKCDILK
PMCKCDILK
Retrocopy
PMCKCDILK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide