RetrogeneDB ID:
retro_mputfur_341
Organism:
Location:
GL896904.1:18211589-18212023 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
67.81 %
Coverage:
53.73 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
MAPRE1
Parental gene aliases:
No gene alias available
Parental gene description:
microtubule-associated protein, RP/EB family, member 1 [Source:HGNC Symbol;Acc:6890]

Genomic region (view in browser)





>retro_mputfur_341
TATGACCCTGCAGCTTACAGACTTGGTCAAGGAACTGCAGGGGCTCCCTCCCTTGTAGCT
CTAGCTCTGAATAAACCCAAGAAACCTCTCAGCTCTAGTAGTGAGCTCCCCAGAAGCCCT
CACTGTAACACAGAGAACCATGGTAACCCTGGAGGCCAGCCTGGGTGTGGTGTGAAAGAA
TCCTGGTGTGAGCAACAGAGATGATGGAGCAGCTGAGTCGATACAGCAGGTCAACATATC
AAAACTTACTGTCTAAGACTCAGAGACAGAGAGACGTTTCTACTTTGGAAAGCTAAGGAA
CATGGAATTGATTTGCCAAGAGAGCGAGAGGGAAAACAACCTTGTATTGCAGAGCTGTGT
GGACATTCTCTATGGCACAGATGAAGGCTTTGTGTTACCTGCCAAAGGGGGGGCTGCAGG
AGGGGCAAGAAGAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
YDPVAARQGQETAVAPSLVAPALNKPKKPLSSSSAAPQRP-IATHRTTATPKTGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLR
YDP.A.R.GQ.TA.APSLVA.ALNKPKKPLSSSS..P..P...T.RT..T.....GVV.KNPGV.N.DD.AAE..QQVN..KLTV.D.E.ER.FYFGKLR
Retrocopy
YDPAAYRLGQGTAGAPSLVALALNKPKKPLSSSSELPRSP\TVTQRTMVTLEASLGVV*KNPGVSNRDDGAAESIQQVNISKLTV*DSETERRFYFGKLR


Parental protein
NIELICQENEGENNPVLQRIVDILYATDEGFVIPDEGGP-QEEQEE
N.ELICQE.E.ENN.VLQ..VDILY.TDEGFV.P..GG..QE.QE.
Retrocopy
NMELICQESERENNLVLQSCVDILYGTDEGFVLPAKGGA\QEGQED


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide