RetrogeneDB ID:
retro_mputfur_351
Organism:
Location:
GL896904.1:25656976-25657328 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
65.29 %
Coverage:
51.08 %
Frameshifts:
3
Stop codons:
2


Parental gene:
Parental gene symbol:
PAFAH1B3
Parental gene aliases:
No gene alias available
Parental gene description:
platelet-activating factor acetylhydrolase 1b, catalytic subunit 3 (29kDa) [Source:HGNC Symbol;Acc:8576]

Genomic region (view in browser)





>retro_mputfur_351
AGCAAGTCCCTGCGGGTGCAGGACATGCAGGACAATGGACACTGAATGTCCCTGCACCTG
GGTTCATAGCCCACAGCAAAGATAAGGAACACAAAGTCTTCTTACTCAGGAATTCCTGGG
TCCATCTAATGCACCAGTGCAAGATCTGGCGGGAGCTCTTTTATTCTCTGCACATTCTTA
ACTTCGGTATTGGTAGTGACACATAACAGGTGCTTTGGCAGCTGGAGAATTGGGGAGCTG
GAACAAATCTGGCCCAAGACTGTAGTGGTCTGGAGTGAGTACCAACCACCACAGGCACAT
AGCAGAGCAAGTGACTGGTGGCATCGAGACCATCGTCCAGCTGGTGAACCAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SKPTPVQDVQGDGRWMSLH-HRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGSDSTQHVLWRLEN-GELEHIRPKIVVVW-VGTNN
SK...VQD.Q..G..MSLH...F.A.SKDKE..V.....S.V.LMHQC.IWRELF..LH.LNFGIGSD..Q.VLW.LEN.GELE.I.PK.VVVW.V.TN.
Retrocopy
SKSLRVQDMQDNGH*MSLH/PGFIAHSKDKEHKVFLLRNSWVHLMHQCKIWRELFYSLHILNFGIGSDT*Q-VLWQLEN\GELEQIWPKTVVVW\VSTNH


Parental protein
HGHTAEQVTGGIKAIVDLVNQ
H.H.AEQVTGGI..IV.LVNQ
Retrocopy
HRHIAEQVTGGIETIVQLVNQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide