RetrogeneDB ID:
retro_mputfur_354
Organism:
Location:
GL896905.1:4290307-4290942 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
84.51 %
Coverage:
72.11 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
VDAC2
Parental gene aliases:
No gene alias available
Parental gene description:
voltage-dependent anion channel 2 [Source:HGNC Symbol;Acc:12672]

Genomic region (view in browser)





>retro_mputfur_354
TCACAGAAAAATGGAACACTGATAACACTAGGAACAAAAATCGCAACTGAAGACCTGATT
TGTCAAGGTTTGAAACTGACATTTGATATCACCTTCTCATCAAACACGGGAAAGAAAAGT
GGTAAAATCAAGTCTCCTTATAAGAGGGAGTGTATAAACCTTGGTTGTGATGTTGACTTT
GATTTTGCTGGACCTGCAATCCATGGTTCAGCTGTCTTTGGTTACGAAGGCTGGCTTGCT
GGGTATCAGATGACTTTATAGACTGTGCCAAATCAAAGCTGACAAGATAACTTTGCAGTG
GGCTACAGGACTGGGGACTTCCAACTACACATTAATGTCAATGATGGGACAGAATTTGGA
GGATCAATTTATCAAAAAGCATGTGAAGATCTCGACAATTCAGTAAACCTTGCTTGGACA
TCAGGTACCAACAGCACTCGCTTTGGCACTGCAGCCAAGTATCAGTTGGATCCCACTGCT
TCCCTTTCTGCAAAAGTCAACAATTCTAGTTTAATTGGAATGGGCTACACTCAGACTCTG
AGGCCTGGTGTCAGGCTTACACTGTCTGCTCTGGTAGACAGGAAGAGCATAATGCTGAAG
GCCACAAACTTGGGCTTGCCCTGGAGTTGGAAGCT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAV
..K..T..TLGT.IA.ED.ICQGLKLTFD.TFS.NTGKKSGKIKS.YKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMT...........NFAV
Retrocopy
SQKNGTLITLGTKIATEDLICQGLKLTFDITFSSNTGKKSGKIKSPYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTL*TVPNQS*QDNFAV


Parental protein
GYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNSTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSI-NA
GYRTGDFQLH.NVNDGTEFGGSIYQK.CEDLD.SVNLAWTSGTNSTRFG.AAKYQLDPTAS.SAKVNNSSLIG.GYTQTLRPGV.LTLSALVD.KSI.NA
Retrocopy
GYRTGDFQLHINVNDGTEFGGSIYQKACEDLDNSVNLAWTSGTNSTRFGTAAKYQLDPTASLSAKVNNSSLIGMGYTQTLRPGVRLTLSALVDRKSI/NA


Parental protein
GGHKLGLALELEA
.GHKLGLALELEA
Retrocopy
EGHKLGLALELEA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide