RetrogeneDB ID:
retro_mputfur_357
Organism:
Location:
GL896905.1:7199278-7199563 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
67.96 %
Coverage:
63.29 %
Frameshifts:
3
Stop codons:
0


Parental gene:
Parental gene symbol:
RPL19
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L19 [Source:HGNC Symbol;Acc:10312]

Genomic region (view in browser)





>retro_mputfur_357
ATGCTCAGGTTTCAGAAGAGGCTTGCCTCCAGGGTCCTCTGCTGTGACAAAAGAAGGTCT
GGTTGGCTCCAGGGAGACCAAGGAGATCACCAGTGCCTATGCCTATCGGCAGATCCGGAA
ACTGATCAAAGACAGACTGATCATCTGGAAGCCTGTACCCTCCATTCCTGTGCTCCGTGC
AGGAAAAATACCTTGGCCTGCCAGAAGGGCTCTGGTGAGAGAAAAGGTTCTGCTCCGGCT
GGAATGCCCCAGAAGGTAACCTGGATGAGGAGGATGAGAATTCTG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MLRLQKRLASSVLRCGK-KKVWLDPN-ETNEIANANSRQQIRKLIKDGLIIRKPV-TVHSRARCRKNTLARRKGRHMGIGKRKGTANARMPEKVTWMRRM
MLR.QKRLAS.VL.C.K.KKVWL.P..ET.EI..A....QIRKLIKD.LII.KPV.T.HS.A.CRKNTLA..K....G.G.RKG.A.A.MP.KVTWMRRM
Retrocopy
MLRFQKRLASRVLCCDK/KKVWLAPG/ETKEITSAYAYRQIRKLIKDRLIIWKPV/TLHSCAPCRKNTLACQK----GSGERKGSAPAGMPQKVTWMRRM


Parental protein
RIL
RIL
Retrocopy
RIL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide