RetrogeneDB ID:
retro_mputfur_36
Organism:
Location:
GL897494.1:93458-94187 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
73.83 %
Coverage:
89.32 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
FTH1
Parental gene aliases:
No gene alias available
Parental gene description:
ferritin, heavy polypeptide 1 [Source:HGNC Symbol;Acc:3976]

Genomic region (view in browser)





>retro_mputfur_36
ATGCTGCCCTGTTTCTTGTTTCTCTCCAAGAACATCAGCCCTTCGCTGTTGTCCCTGCGC
AACGCGCGCCGGGGCTTCGCGCTCCCGCCGCTCCGGGTCTCCAGGCTCCCCTCGCGCCCC
AGGCGCACTGCCCCACTGCGCCCGCTGGCAGCAGCCGCCGCCTCCGGGGACCCAGCCGGG
CCCGCCTCCGCCCATTCCCGGGTGCGCCAGAACTTCCACCCGGACTCCGAGGCTGCCATC
AACCGCCAGATTAACCTGGAGCTCTACGCGTCCTACGTGTACCTGTCCATGTCCTATTAC
TTCTCCCGAGATGACGTGGCCCTGAACAACTTCGCGGGGTATTTCCTTCGCCAGTCCCGG
GAAGAGACCCAGCACGCGGAAAAGCTGATGAGGCTGCAGAACCAGCGGGGAGGCCGGATC
TGCCTGCAGGACATCAAGAAACCAGACCAGGACGACTGGGAAAGCGGGCTGAACGCCATG
GAGTGTGCGCTGCTCTTGGAGAAGAATGTGAATCAGTCGTTGCTCGAATTGCACACTCTG
GCCTCAGACAGAGGTGACCCCCACTTGTGCGACTTCCTGGAAACTCACTATCTGAATGAG
CAGGTGAAGTCTATCAAAGAACTAGGTGACCACATGCAAAACTTGATTAAGATGGGGGCC
CCAGATTCTGGCCTGGCAGAGTATCTCTTTGACAAGCACACCCTGGGAGATGAAAACAAT
CAGAACTAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PLRASPPPSPHSVLGPLQGPPSPAAAATTTASP----SQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEK
PLR.S..PS......PL..P...AAA....A.P....S.VRQN.H.DSEAAINRQINLELYASYVYLSMSYYF.RDDVAL.NFA.YFL.QS.EE..HAEK
Retrocopy
PLRVSRLPSRPRRTAPLR-PLAAAAASGDPAGPASAHSRVRQNFHPDSEAAINRQINLELYASYVYLSMSYYFSRDDVALNNFAGYFLRQSREETQHAEK


Parental protein
LMKLQNQRGGRIFLQDIKKPDRDDWENGLNAMECALHLEKSVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKSIKELGDHVTNLRKMG-PESGMAEY
LM.LQNQRGGRI.LQDIKKPD.DDWE.GLNAMECAL.LEK.VNQSLLELH.LA.D..DPHLCDF.ETHYLNEQVKSIKELGDH..NL.KMG.P.SG.AEY
Retrocopy
LMRLQNQRGGRICLQDIKKPDQDDWESGLNAMECALLLEKNVNQSLLELHTLASDRGDPHLCDFLETHYLNEQVKSIKELGDHMQNLIKMGAPDSGLAEY


Parental protein
LFDKHTLGNSDSES
LFDKHTLG......
Retrocopy
LFDKHTLGDENNQN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide