RetrogeneDB ID:
retro_mputfur_361
Organism:
Location:
GL896905.1:15535430-15535862 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
60.81 %
Coverage:
52.19 %
Frameshifts:
4
Stop codons:
2


Parental gene:
Parental gene symbol:
NECAP1
Parental gene aliases:
No gene alias available
Parental gene description:
NECAP endocytosis associated 1 [Source:HGNC Symbol;Acc:24539]

Genomic region (view in browser)





>retro_mputfur_361
GAGATAGTGACAGATTCTAGCTTCTACTGTGTAATCTGGTCCCAGGATGACACTGGGCAT
AGAGCTTTCATTGATATTTACTTCATGGATCAGGTGATGTCTTTGAATTTAATATCCTCC
CACAAAATTACTTGAAGTGGGTAAAGTAAGTATCTAAGTTGTCCAGTGAATCTCAAGAAC
TGGACATTCATCCCAAGTTGGATCTGGGCCTCAAAGAAGGACAGATCATCAAGTTGAGTA
ACATTAACATTGCAACCAAGAGATGATGGGTTTCTAAGCCCAGGACTACAGGGGACTGGG
GGCCTAAATTTACTCCCAGACCCACTTGGAGGCAAAGTCATTATTCCCCCTCTATCCTCA
GAGGATGTCATGAGCAGTCATGTTGCCCCCACCACCCATTCCAAATCTAACCACGGAAGC
AATGACACAGAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ETVTDSSRYFVIRIQDGTGRSAFIGIGFTDR-GDAFDFNVSLQDHFKWVKQESEISKESQDMDNRPKLDLGFKEGQTIKLSIGNITTKKGGASKPKTT-G
E.VTDSS.Y.VI..QD.TG..AFI.I.F.D..GD.F.FN...Q...KWVK..S..S.ESQ..D..PKLDLG.KEGQ.IKLS..NI.TK....SKP.TT.G
Retrocopy
EIVTDSSFYCVIWSQDDTGHRAFIDIYFMDQ/GDVFEFNILPQNYLKWVK*VSKLSSESQELDIHPKLDLGLKEGQIIKLSNINIATKR*WVSKPRTT\G


Parental protein
AGGLSLLPPPPGGKVTIPPPSSV-AISNHVT-PPPIP-KSNHGGSDAD
.GGL.LLP.P.GGKV.IPP.SS....S.HV..PPPIP.KSNHG..D.D
Retrocopy
TGGLNLLPDPLGGKVIIPPLSSEDVMSSHVA\PPPIP/KSNHGSNDTD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide