RetrogeneDB ID:
retro_mputfur_362
Organism:
Location:
GL896905.1:17994803-17995474 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
67.98 %
Coverage:
70.35 %
Frameshifts:
3
Stop codons:
4


Parental gene:
Parental gene symbol:
RPLP0
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein, large, P0 [Source:HGNC Symbol;Acc:10371]

Genomic region (view in browser)





>retro_mputfur_362
CTTTTAGGTGAATAACCAAAATGCTTCATTGTGGGAACAGGCAAAATTGGTTCCAAGCAG
ATGCAGCAGATCCATATGGCCCTCCACGGGAAGGCTGTGGGGCCGATGGCAAGAGCACCA
TGATAGACAAGGCCATCTGAAGGCATCTGGAGAACCAGCCTGCTCTGGAGAAAACTATTG
CCTCACATGAGGAGGAATGTGGGCTTTACGTTCACCGAGAAGGACTTCACTGAAATCACG
GACATGCTGCTGGCCAATAAGTAGCCAGCTGTCACCTGTGCTTGTGCCAAAGCTCCATGT
AAAGTCTTTGTGTCAGCTCAGAACACTGGTCTGGGGCTCAAGAAGACCGCCTTCTTCCAG
GCTTTAGGTATCACCACTAAAATCTCCAGGGGCACCATTGAAATCCTGAGTGATGTGCAA
ACGTTTAACACAGAGACAAAGTGGGAGCAGGCAAAATCATAGTGCTTACCATGCTAAACA
TCTCCATCCCGGCCTTCTCCTTTGGGATAACCATTCAGTAGGTGTTTGACAATGGCAGCA
TCTACAGCCCTGAAGTCTTGACATCACAGAGGAAACTGCATTCTTGCTTCATGGAAAATA
TCCCCAAGGTTGCCAGTGTATGTCTGCAGACAGGTTACCTGACCATTGCATCAGTGCCCC
ATTCTACCATC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLM-GKNTMMRKAIRGHLENNPALEK-LLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIA
LL...PKCFIVG....GSKQMQQI.M.L.GKAV..M.GK.TM..KAI..HLEN.PALEK.LLPH.R.NVGF.FT..D.TEI.DMLLANK.PA...A.A.A
Retrocopy
LLGE*PKCFIVGTGKIGSKQMQQIHMALHGKAVGPM/GKSTMIDKAI*RHLENQPALEK\LLPHMRRNVGFTFTEKDFTEITDMLLANK*PAVTCACAKA


Parental protein
PCEVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTG-DKVGASEATLLNMLNIS--PFSFGLIIQQVFDNGSIYNPEVLDITEETLHSR
PC.V.V.AQNTGLG..KT.FFQALGITTKISRGTIEILSDVQ...T..DKVGA.....L.MLNIS...FSFG..IQ.VFDNGSIY.PEVL......LHS.
Retrocopy
PCKVFVSAQNTGLGLKKTAFFQALGITTKISRGTIEILSDVQTFNTE/DKVGAGKIIVLTMLNISIPAFSFGITIQ*VFDNGSIYSPEVLT-SQRKLHSC


Parental protein
FLEGVRNVASVCLQIGYPTVASVPHSII
F.E....VASVCLQ.GY.T.ASVPHS.I
Retrocopy
FMENIPKVASVCLQTGYLTIASVPHSTI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide