RetrogeneDB ID:
retro_mputfur_364
Organism:
Location:
GL896905.1:19420513-19420835 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
68.75 %
Coverage:
63.43 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
TPT1
Parental gene aliases:
No gene alias available
Parental gene description:
tumor protein, translationally-controlled 1 [Source:HGNC Symbol;Acc:12022]

Genomic region (view in browser)





>retro_mputfur_364
ATGATCATGTACTGGGACCTCATCAGCCGTGATGAGATGTTTGTCATCTACAAGATCCGA
GAGATGGTGGACAGGCTGGGGCTGGAGGTGGAGGTGAAGGTGGTCAGTACGACAGAGGAT
AATACTGATGACTCACTCATCGGTGGAAATGCCTCCACTGAAGACCCCGAGGGTGAAGGT
ATGGAAAGCACAGTAAACACTGGTGTTGATATTAATTGTGAAACGTTACTTATAGAAAAC
CACCTTCAAAAAAGAGGCCTACAAGAAGTACTTCAAAGATTACATGAAATCAGTCAAAGG
CCAACAGAGGCCAGAAAGCGTA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGVDI-VMNHHLQETSFTKEAYKKYIKDYMKSI
MI.Y.DLIS.DEMF..IYKIRE..D.L.LEVE.K.VS.TE.N.DDSLIGGNAS.E.PEGEG.ESTV.TGVDI......L..T.F.KEAYKKY.KDYMKS.
Retrocopy
MIMYWDLISRDEMFV-IYKIREMVDRLGLEVEVKVVSTTEDNTDDSLIGGNASTEDPEGEGMESTVNTGVDI\IVKRYL*KTTFKKEAYKKYFKDYMKSV


Parental protein
KGKLEEQRPERV
KG....QRPE.V
Retrocopy
KG---QQRPESV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide