RetrogeneDB ID:
retro_mputfur_366
Organism:
Location:
GL896905.1:781904-782166 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
61.36 %
Coverage:
60.28 %
Frameshifts:
1
Stop codons:
4


Parental gene:
Parental gene symbol:
POMP
Parental gene aliases:
No gene alias available
Parental gene description:
proteasome maturation protein [Source:HGNC Symbol;Acc:20330]

Genomic region (view in browser)





>retro_mputfur_366
CTCAACCAAAATGAAATGAATTTATCCACATTAAGGCACACCCAGGGTATATGTGCTTTA
TGAAAATTACAAGTTACAAATGGATTCAAGGCAATGCAGTATATTCAGTATCTTCCAGTT
TTTCCTAGCTCAGATCTCTCACTGGATATTTTGAGTAGTAATGATTAAATGACTGATTTT
TTAAGATATTTTGAATGACCCATAACAAAATGAAGGAATGGGAGAACCCCACATGATGGT
AGAACATAAACCTGGTTTACTA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LNQDKMNFSTLRNIQGLFAPLKLQME--FKAVQQVQRLPFLPSSNLSLDILRGND-ETIGFEDILNDPSQSELMGEPHLMVEYKLGLL
LNQ..MN.STLR..QG..A..KLQ....FKA.Q..Q.LP..PSS.LSLDIL..ND.....F.DILNDP.Q.E.MGEPH.MVE.K.GLL
Retrocopy
LNQNEMNLSTLRHTQGICAL*KLQVTNGFKAMQYIQYLPVFPSSDLSLDILSSND\K*LIF*DILNDP*QNEGMGEPHMMVEHKPGLL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide