RetrogeneDB ID:
retro_mputfur_372
Organism:
Location:
GL896905.1:8098206-8098565 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
80.17 %
Coverage:
96.0 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
RPS25
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S25 [Source:HGNC Symbol;Acc:10413]

Genomic region (view in browser)





>retro_mputfur_372
GACAACAAGAAAAAAGATCCTGGAAAGTCGCCCAAGAAAGACAAAGACCCAGTGAACAAA
TCTGGGGCCAAGGCCAAAAAGAAGAAGTGGTCCAAAGGCAAAGTTCAGGACAAGCTCAAT
GACCTGGTCTTGTTTGACAAAGTGACATATGCCAAACTCTGTAAGGAAGTTCCCAACTAT
AAGCTTATAATCCCAGCTGTTGTCTCTTAGACACAAAGATTCGGAGTTCCCTGGCCAGGG
GAGCCCTTCAGGAACTCCTTAGTAAAGGATTCACTGAACCAGTCTCAAGGCACAGAGCTC
AAGTCATTTACACCAGAAACACCAAGGATGGAGAGGCCCCAGCTGCTGGTGCAGATGCA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
DKKKKDAGKSAKKDKDPVNKSGGKAKKKKWSKGKVRDKLNNLVLFDKATYDKLCKEVPNYKLITPAVVSERLK-IRGSLARAALQELLSKGLIKLVSKHR
D.KKKD.GKS.KKDKDPVNKSG.KAKKKKWSKGKV.DKLN.LVLFDK.TY.KLCKEVPNYKLI.PAVVS.....IR.SLAR.ALQELLSKG....VS.HR
Retrocopy
DNKKKDPGKSPKKDKDPVNKSGAKAKKKKWSKGKVQDKLNDLVLFDKVTYAKLCKEVPNYKLIIPAVVS*TQR/IRSSLARGALQELLSKGFTEPVSRHR


Parental protein
AQVIYTRNTKGGDAPAAGEDA
AQVIYTRNTK.G.APAAG.DA
Retrocopy
AQVIYTRNTKDGEAPAAGADA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide