RetrogeneDB ID:
retro_mputfur_378
Organism:
Location:
GL896905.1:25029464-25029779 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
61.11 %
Coverage:
86.89 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
Gm2178
Parental gene aliases:
No gene alias available
Parental gene description:
predicted gene 2178 [Source:MGI Symbol;Acc:MGI:3780348]

Genomic region (view in browser)





>retro_mputfur_378
CTAGAGGCATTTAGATGACCCAGCATCTGAGGTACCATCGCAGGCTGTCCTACGACATAG
CCTCTGACAAAACCAGGCTGTCCCGAGCTCCTGGTAACAGAATTGTTTCCCTTTATACCG
AGAAGGTTAGGAAAGCACCAAAACATGTGTGGGGCTTTCCTGGGCTGACATCGAGGAGGT
CATGCTGTGAGACCTCACCTTCCTATCAAGTTGCCTCAAATGAACAAACATGTCAGCAGG
GCCGATGGTGGTTCCATGTCTGCTAAATGTGTCCACAACGGGATCAAATGTACTTTCCTT
ACTGAGGATCAGAAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MKAFR-MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRL-RGVRAVRPKVLMRLSKTKKHVSRAYGGSMCAKCVRDRIKR
..AFR.M.Q.L.Y.RRLSY..AS.KTRLSR.PGNRIV.LYT.KV.KAPK...G..PG...RG..AVRP.....L....KHVSRA.GGSM.AKCV...IK.
Retrocopy
LEAFR/MTQHLRYHRRLSYDIASDKTRLSRAPGNRIVSLYTEKVRKAPKHVWGF-PGLT\RGGHAVRPHLPIKLPQMNKHVSRADGGSMSAKCVHNGIKC


Parental protein
AFLIEEQK
.FL.E.QK
Retrocopy
TFLTEDQK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide