RetrogeneDB ID:
retro_mputfur_382
Organism:
Location:
GL896906.1:3854590-3854953 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
63.93 %
Coverage:
95.31 %
Frameshifts:
0
Stop codons:
2


Parental gene:
Parental gene symbol:
Gm11808
Parental gene aliases:
No gene alias available
Parental gene description:
predicted gene 11808 [Source:MGI Symbol;Acc:MGI:3649356]

Genomic region (view in browser)





>retro_mputfur_382
AGCCTGATAGGCAAGGTCATCACCCTCCAGATAGAGCCCGGTGACACCAGTGAGAATGTT
AAAGCCAAAATCCAAGGCCAGGAGGGCATCTTCCCAAACCAACAGCATCTTATTTTTGTG
GGCAAACAGCAGGAGGATAGCCACAGCCTCTCAGACTACAACATCCAAAAAAGAGTCTAC
CTGCACTTGGTGCTTCACCCGTGGGGTGGCATCATTGAACCTTCACTCAGCCAGCTGACC
CAGAAATACAACTGCTGAAAGATGATCTGACACAAGTGTTATACTCACCTGCAGCCCGCT
GATGTCAGCTGTTGCAAAAGTGCAACCACAACAACAGCCTGTGCCCCCAAGAAGAAGGTC
AAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLHPR
.L.GK.ITL..EP.DT.ENVKAKIQ..EGI.P.QQ.LIF.GKQ.ED...LSDYNIQK...LHLVL...GGIIEPSL.QL.QKYNC.KMI..KCY..L.P.
Retrocopy
SLIGKVITLQIEPGDTSENVKAKIQGQEGIFPNQQHLIFVGKQQEDSHSLSDYNIQKRVYLHLVLHPWGGIIEPSLSQLTQKYNC*KMI*HKCYTHLQPA


Parental protein
AVNCRKKKCGHTNNLRPKKKVK
.V.C..K....T....PKKKVK
Retrocopy
DVSC-CKSATTTTACAPKKKVK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide