RetrogeneDB ID:
retro_mputfur_383
Organism:
Location:
GL896906.1:5663023-5663593 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
56.77 %
Coverage:
97.96 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
CHMP1A
Parental gene aliases:
No gene alias available
Parental gene description:
charged multivesicular body protein 1A [Source:HGNC Symbol;Acc:8740]

Genomic region (view in browser)





>retro_mputfur_383
CTGTTCAACCTAAAGTTCGCCGCCAAAGAACTCAGCAGGAGTGCCAAAAAATGCGACAAG
GAGGAAAAGGCCGAAAAGGCCAAGATTAAAAAGGCCATTCAGAAGGGCAACATGGAAGTG
GCGAGGATACACGCCGAAAATGCCATTCGCCAGAAGAACCAGGCGGTGAATTTCTTGAGA
ATGAGTGCGCGGGTCGATGCGGTGGCTGCCAGAGTCCAGACGGCGGTGACGATGGGCAAG
GTGACCAAGTCGATGGCCGGTGTGGTTAAGTCGATGGATGCGACGTTGAAGACTATGAAT
CTGGAGAAGATCTCTGCTCTGATGGACAAATTCGAGCACCAGTTTGAGACGCTGGACGTC
CAGACGCAGCAAATGGAAGACACGATGAGCAGCACGACGACGCTGACCACTCCCCAGAAC
CAAGTGGATATGCTGCTCCAGGAAATGGCAGACGAGGCTGGCCTAGACCTCAACATGGAG
CTGCCGCAGGGGCAGACCGGCTCCGTAGGCACTAGCGTGGCTTCCGCCGAGCAGGATGAA
CTGTCCCAGAGACTGGCCCGCCTGCGAGAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALQQKNVECARVYAENAIRKRNEGVNWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDRALSTMD
LF.LKF.AK.L...AKK..K..KAE.AK.KKA.Q..N.E.AR..AENAIR..N..VN.LRM..RVDAVA..VQTAVTM..VTK.MA.V.K..D..L.TM.
Retrocopy
LFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMN


Parental protein
LQKVSAVMDRFEQQVQNLDVHTSVMEDSMSSATTLTTPQEQVDSLIVQIAEENGLEVLDQLSQLPEGASAVGESSVRSQEDQLSRRLAALRN
L.K.SA.MD.FE.Q...LDV.T..MED.MSS.TTLTTPQ.QVD.L....A.E.GL.....L.Q...G...VG.S......D.LS.RLA.LR.
Retrocopy
LEKISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTG--SVGTSVASAEQDELSQRLARLRD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide