RetrogeneDB ID:
retro_mputfur_389
Organism:
Location:
GL896906.1:18227239-18227566 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
55.05 %
Coverage:
78.68 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
H3F3B
Parental gene aliases:
No gene alias available
Parental gene description:
H3 histone, family 3B (H3.3B) [Source:HGNC Symbol;Acc:4765]

Genomic region (view in browser)





>retro_mputfur_389
AAACAGACCACCCACAAATCCACGGCTGGGAAGGGGCCTTGCAAAGCCCACAGGAGAAGC
ACCCTTTCTACCGCCAGGGTGAAAACACCCCATGGCCACAGGCCCAGGCCCACTGCACTT
CTGGAGGCCTGTGGTTATCAGAAATCCAATGAGCCTGAGCTTTTTATCCAGAAGCTGCCT
TTCCAGAGGCTGGTGAGGGAGACTGCCCAGGATTTCAAAACCCATCTGAGATTTTAGGGT
GCCGCCACCGGCTCACATCTGGAGACCAGGGAAACATGGCCGGTGGGCTTCTTTGAAGAT
CCTAACCTGGGAGCCATCCACGCTGAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE--LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFED
K.T..K........KA.R.S..ST..VK.PH..RP...AL.E...YQKS.E..L.I.KLPFQRLVRE.AQDFKT.LRF..AA.G...E..E...VG.FED
Retrocopy
KQTTHKSTAGKGPCKAHRRSTLSTARVKTPHGHRPRPTALLEACGYQKSNEPELFIQKLPFQRLVRETAQDFKTHLRF*GAATGSHLETRETWPVGFFED


Parental protein
TNLCAIHAK
.NL.AIHA.
Retrocopy
PNLGAIHAE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide