RetrogeneDB ID:
retro_mputfur_390
Organism:
Location:
GL896906.1:19775836-19776259 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
69.44 %
Coverage:
67.79 %
Frameshifts:
3
Stop codons:
1


Parental gene:
Parental gene symbol:
RPL7
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L7 [Source:HGNC Symbol;Acc:10363]

Genomic region (view in browser)





>retro_mputfur_390
GTGTTGTAACTTCTTTGCCTCGACCAGATCCTCATTGGCACCTTTGTTAAGCTCAACAAG
GCCTCAGTTGACATGCTAAGGATTGTGGAACCATACGTAGCATGAGGGGGACCCAGACCT
GAAGTTGGTGAATGAATTGATCTTCAAGTGTGGTTCTGGCAAAATCAACCATGAAGCAAA
TTGCCCTGTCAGAGAGCACATTGATTGCCCCATCTCGTCATAAATATGGCACCATCTGCA
TAGAGGGTCTGATTCACGAGGTCTATTCTGTTGGAAAACGTTTCAAAGAAGCAAACAACT
TCTTGGCCCTTCAAAAGATCTCCTCCATGAGGGGGTATGAAGAAAAAGACCACCCATCTT
GTAGAAAGTGGAGATGCTGGCAACAGGGAGCACCAGATCAACAGGATTATTACAAGGATG
AAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VLQLLRLRQIFNGTFVKLNKASVNMLRIVEPYIA-WGYPNLKSVNELIYKRGYGKINK-KRIALTDNTLIARSLGKYGIICMEDLIHEIYTVGKRFKEAN
VL.LL.L.QI..GTFVKLNKASV.MLRIVEPY.A..G.P.LK.VNELI.K.G.GKIN..K.IAL...TLIA.S..KYG.IC.E.LIHE.Y.VGKRFKEAN
Retrocopy
VL*LLCLDQILIGTFVKLNKASVDMLRIVEPYVA\EGDPDLKLVNELIFKCGSGKINH\KQIALSESTLIAPSRHKYGTICIEGLIHEVYSVGKRFKEAN


Parental protein
NFLWPFKLSSPR-GGMKKKTTHFVEGGDAGNREDQINRLIRRMN
NFL...K.SS.R.G..KK.T.H.VE.GDAGNRE.QINR.I.RMN
Retrocopy
NFLALQKISSMR\GMKKKTT-HLVESGDAGNREHQINRIITRMN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide