RetrogeneDB ID:
retro_mputfur_391
Organism:
Location:
GL896906.1:20932800-20933948 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
64.54 %
Coverage:
58.87 %
Frameshifts:
3
Stop codons:
7


Parental gene:
Parental gene symbol:
FAM178B
Parental gene aliases:
No gene alias available
Parental gene description:
family with sequence similarity 178, member B [Source:HGNC Symbol;Acc:28036]

Genomic region (view in browser)





>retro_mputfur_391
GTACATCCCAGTGAGACAGTGCTTTTACCCAGGTGTCACCTCCTGCATTGTATCCTGGAT
TGTTCACACCTGAAGCCACATAGCTCCTTGAAGGGGCTGTTCTTCAGATGCCCTGTGGCC
CAGCAGCTATCCTTCCCGCACAGTGGCCTCATGACCAACCTCTACCTGTGCACCCTTGAC
TGCCTGATGCCTCTGCTCCAGTGGCTCTTCCAGTGGCTGATGTGGCCTCCAGAAACTTGT
TCAGGAGCCTTTGGCTTCCTATGGGATCTTAGTATGGATAGGTTCTTCCATCAGTTTGAT
GGAGATAAGCACTGGTTGTGGCCCTCACTGCAAGAGGTCATGGAGGGATTTCACAGACTG
GGAGGCCACAATCCTGCTCTGGGACTGCAGGGGCCCTGTCAGCATGGTGGAAGAGTGTTT
AAAAATGACACTAGCCTGAGCTGGAGTGAGCAGCAGAACAGCCCCCTGGAGACTGGCTGA
GACATTAGCCTGAGCTATCTCTATTAAGTTCCTGTCACTGAGTACCCTTGCATAGACAGG
GGCCTCCACTGATGGGGACCTCTTGGGCCAAACTGAGCTTCTGTCCTGAGCTGGTGTGGG
AGGCAGGGGGCGGCGGCTCTGCCTGCCACACAAGACCAATCTCCAGCAGTTTCTGCTCCT
GCTCTTCAAGAACATCCAGGAGTGGCCAGGGAAGCTCCAGCAGCTGTGCTGTACCCTGAG
CAAGGTGTCAGATCACCATTACAACTGCTGGCACTCATGAAGTTCTTCCTGGATGTAACC
TTCTGGAGCAGACAGCTGTGAAGCCAGCTTAGCCTTGTGGTCTTTGCCCAGATCCTGGAC
TAGCAAGAGACATTCCCTGTCTGGCAAGAGAAGGCCCAGCTGTCTTTGCTCAGCCAGATC
CTAAGCCTCATGAGGCCATAATCCCTCTGGTAGTACCTGGGCTCTGAGACCTTGCCACCT
TACCAGAAGCAAGAGCCAAAGGCCAGTGCTGAGCTAGATCACCTGTGCCACAGCTTCTGA
TACTGCCTAGGGTGGTGGTCAGCTGCCAAGACTCCCCATCCCAGACCAGTGGGGAGAACT
GCAGCTTGCTATGCATGCAATTGGGCCTCCATATTAGCACCCATATCCAGGAGAGCCCCC
AGGCCATG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VHPGEMVFLPRHQPLPCILDHSQLKPRSHLEERFLSCPPAQQLSFLRMGLLSNLYLHTPDCPVALLRWLFQLLTWPPETSSGAFSLLWDLSVDGLFHLSD
VHP.E.V.LPR...L.CILD.S.LKP.S.L...F..CP.AQQLSF...GL..NLYL.T.DC...LL.WLFQ.L.WPPET.SGAF..LWDLS.D..FH..D
Retrocopy
VHPSETVLLPRCHLLHCILDCSHLKPHSSLKGLFFRCPVAQQLSFPHSGLMTNLYLCTLDCLMPLLQWLFQWLMWPPETCSGAFGFLWDLSMDRFFHQFD


Parental protein
GDKRWWCPSLQEVMETFHSLGARSPALDPSQPESEWTSGKVLKNDINLSWSQQQDNPPETALDFSLSYI-CKFLALCALAQPTAYTDGELLGLIELLCRA
GDK.W..PSLQEVME.FH.LG...PAL....P......G.V.KND..LSWS.QQ..P.ET..D.SLSY...KFL.L..LA...A.TDG.LLG..ELL..A
Retrocopy
GDKHWLWPSLQEVMEGFHRLGGHNPALGLQGPCQH--GGRVFKNDTSLSWSEQQNSPLETG*DISLSYL\IKFLSLSTLA*TGASTDGDLLGQTELLS*A


Parental protein
GL-DVGLRL-LP-KTDLQQLLLLLLENIHEWPGQLQPLCCTLSKVSDHHHN-LLALVQFFMDVTSRSRQLRSQLSLLVIAQMLDQQETFPLWQEKAQLFL
G....G.RL.LP.KT.LQQ.LLLL..NI.EWPG.LQ.LCCTLSKVSDHH.N.LLAL..FF.DVT..SRQL.SQLSL.V.AQ.LD.QETFP.WQEKAQL.L
Retrocopy
GVGGRGRRLCLPHKTNLQQFLLLLFKNIQEWPGKLQQLCCTLSKVSDHHYN/LLALMKFFLDVTFWSRQL*SQLSLVVFAQILD*QETFPVWQEKAQLSL


Parental protein
LSQLLSLMRPSSLRQHLGSVTLPPGQEQQPKASAELDHKACYLCHS-LLMLAGVVVSCQDITPDQWGE-LQLLCMQLDRHISTHIRESPQAM
LSQ.LSLMRP.SL...LGS.TLPP.Q.Q.PKASAELDH....LCHS.LL.L..VVVSCQD......GE...LLCMQL..HISTHI.ESPQAM
Retrocopy
LSQILSLMRP*SLW*YLGSETLPPYQKQEPKASAELDH----LCHS/LLILPRVVVSCQDSPSQTSGENCSLLCMQLGLHISTHIQESPQAM


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide