RetrogeneDB ID:
retro_mputfur_392
Organism:
Location:
GL896906.1:24971867-24972223 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
71.9 %
Coverage:
58.25 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
BTF3
Parental gene aliases:
No gene alias available
Parental gene description:
basic transcription factor 3 [Source:HGNC Symbol;Acc:1125]

Genomic region (view in browser)





>retro_mputfur_392
AAACATCAGTTCTTCTTGAAGAAGTTAGGGGCAAACAATATCTCTGGTACTGAAGAAGGG
AATATGTTCACAAACCAAGAAACTGTGATCTATTTTCACAACCGTAAAGGTCAGGCATTC
CTGGCAGTGAACACTTTCATCATTCCAGGCCACGCTGACACAGAGCAGTGGAAGGAAATG
CCGCCCAGTATCTTAAGCCAACTTGATACAGACAGTTTGACTAATTTAAGAAGACTGGCT
GAAGCTCTGCCACACAGTCTGTGGATGAGGCCTCACTTGCTATTGCAGAGGATGATGATG
ATGAAGTTTCAGATTTCGTGGAGAATCTTGATGAAGCTCCCAAGAATGAAGCAAAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KLQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRLAEALP-KQSVDGKAPLATGED
K.QF.LKKLG.NNISG.EE.NMFTNQ.TVI.F.N.K.QA.LA.NTF.I.GHA.T.Q..EM.PSIL.QL..DSLT.LRRLAEALP..QSVD..A.LA..ED
Retrocopy
KHQFFLKKLGANNISGTEEGNMFTNQETVIYFHNRKGQAFLAVNTFIIPGHADTEQWKEMPPSILSQLDTDSLTNLRRLAEALP/TQSVD-EASLAIAED


Parental protein
DDDEVPDLVENFDEASKNEAN
DDDEV.D.VEN.DEA.KNEAN
Retrocopy
DDDEVSDFVENLDEAPKNEAN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide