RetrogeneDB ID:
retro_mputfur_394
Organism:
Location:
GL896907.1:1033479-1033921 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
57.62 %
Coverage:
72.33 %
Frameshifts:
2
Stop codons:
5


Parental gene:
Parental gene symbol:
MRPL40
Parental gene aliases:
No gene alias available
Parental gene description:
mitochondrial ribosomal protein L40 [Source:HGNC Symbol;Acc:14491]

Genomic region (view in browser)





>retro_mputfur_394
CTGGGAACTTAACAGGCACAGATTAGGAACAACCACCAGGGAGCTGCATCACTGACCTTC
TGGGAATTCATTCTCATGAGATCAGAATCTCTGCAAAAGAAGAAGATTAATCCTAAAAAA
TACTAAGCAGTGAAGTACCATTTGAAAAAGAGGACCTATTGTCTGGAAAAGACTGGCCAA
GAGCTAATTTCCACTGATGATATTATTATCCCTGTGAGGTTCTTGTTCTTGTAAGACAGC
AACCTTAGGTACAGCTCCCTTTGGAGAAGGGCCAAAGGGGAGCTCTACTTCTGAAAAAGT
GTTTCTGGTACAAGCAGCAAGAGCACAAGATGGAGAAGGATGCCATCAAATCCATGTTTG
AGGCCCAGCAGGAAGCTTTGTGGGAGCTGTGACTCATGACCTAGGAACTCCATGTGAAGC
CATCAAGCGGACTCCCAGTCTG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LGTWQTQIRDTHQRASLLSFWELIPMRAEPLRKKKKVDPKKDQAVKDRLKKRIRRLEKASQELIPIEDFITPVR-LLDKARQRPPVELPFEESERRALLL
LGT.Q.QIR..HQ.A..L.FWE.I.MR.E.L.KKK...PKK..AVK..LKKR...LEK..QELI...D.I.PVR..L...RQ.P.V.LP.E...R.ALLL
Retrocopy
LGT*QAQIRNNHQGAASLTFWEFILMRSESLQKKK-INPKKY*AVKYHLKKRTYCLEKTGQELISTDDIIIPVR/VLVLVRQQP*VQLPLEKGQRGALLL


Parental protein
KKWSLYKHQEHEKERDAIRTMLKSQQEALQELQLMSPELH-AEATKRDLSL
KK...YK.QEH..E.DAI..M...QQEAL.EL.LM..ELH..EA.KR..SL
Retrocopy
KKCFWYKQQEHKMEKDAIKSMFEAQQEALWEL*LMT*ELH/CEAIKRTPSL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide