RetrogeneDB ID:
retro_mputfur_395
Organism:
Location:
GL896907.1:1512574-1512937 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
64.0 %
Coverage:
83.45 %
Frameshifts:
3
Stop codons:
2


Parental gene:
Parental gene symbol:
Rpl26
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L26 [Source:MGI Symbol;Acc:MGI:106022]

Genomic region (view in browser)





>retro_mputfur_395
CTTCACAGGAAGATTATGTCTTCTTCCTCTCTTTCCAAAGAGCTGAGACAGAAGTACAAT
CGTCAATCCATGCCCATCAAAAAGGAGAATGAAGTACGGGTTGGGCAAGAACACTGTAAA
AGTCAGCAGATTGGCAAAGCAGTGCGGGTTTACAGGAAGAAATACACCATCTACACCAAA
TGAGTAAAGTGAGAGAAAGCAAACAACACAACCGTCCATGTGGCCATTCGCCCTAGCAAG
GTGGTTATCACTGGACCAAAAGTGGATGAAAGCTACAAAGATTCTTGAATACAAAGCCCA
AACTTGCCAAGCAGGAAAGGAAGGGGCAAATATAAAGAAGAAACAACTGAGAAGATGCAG
GAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
IRRKIMSSP-LSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDKDRK-KILERK
..RKIMSS..LSKELRQKYN..SMPI.K..EV.V...H.K.QQIGK.V.VYRKKY.IY...V..EKAN.TTVHV.I.PSKVVIT..K.D...K...L..K
Retrocopy
LHRKIMSSSSLSKELRQKYNRQSMPIKKENEVRVGQEHCKSQQIGKAVRVYRKKYTIYTK*VK*EKANNTTVHVAIRPSKVVITGPKVDESYK/RFLNTK


Parental protein
-AKSRQVGKE-KGKYKEETIEKMQE
.A...Q.GKE..GKYKEET.EKMQE
Retrocopy
/AQTCQAGKE/RGKYKEETTEKMQE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide