RetrogeneDB ID:
retro_mputfur_407
Organism:
Location:
GL896907.1:15339954-15340264 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
73.58 %
Coverage:
83.87 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
TMEM254
Parental gene aliases:
No gene alias available
Parental gene description:
transmembrane protein 254 [Source:HGNC Symbol;Acc:25804]

Genomic region (view in browser)





>retro_mputfur_407
GTCACTGTCCTGGTACTGGGCTATTTTGTGTGGGTTGTTTTGTGGCCTCAGAGTATCCCT
TGTCAGAGCCTTGGGCCTCTTGGCTGCTTCACTCAGGATTTCGTGGATCATCATCACACT
TTCTTATATGTGGCCACTGGCTTGCTTGGCTGATTCATGTGGGAGAGTCCTTGTTAGCCA
TGGTTTTGTGTAAGTCTAAAGACATCATGTCTGGATGGCTCAGCTACTTTCGTTCCTACA
AACTTTCCTCTTTGGGATAACATCTCTCTCCATCTTGATTGCTTATGGACGCAAATCCAA
AAAACACACT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VITLSFGYYTWVVFWPQSIPYQSLGPLGLFTQYLVDHHHTFLH-NGYWLAWLIHVGESLYAMVLCKSKGITDG-RAQLLWFLQTFLFGIASLSILIAYRP
V..L..GY..WVV.WPQSIP.QSLGPLG.FTQ..VDHHHTFL...G.WLAWLIHVGESL.AMVLCKSK.I..G..AQLL.FLQTFLFGI.SLSILIAY..
Retrocopy
VTVLVLGYFVWVVLWPQSIPCQSLGPLGCFTQDFVDHHHTFLY/CGHWLAWLIHVGESLLAMVLCKSKDIMSG/MAQLLSFLQTFLFGITSLSILIAYGR


Parental protein
KRQKQT
K..K.T
Retrocopy
KSKKHT


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide