RetrogeneDB ID:
retro_mputfur_408
Organism:
Location:
GL896907.1:17854766-17855400 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
86.32 %
Coverage:
89.74 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
FTH1
Parental gene aliases:
No gene alias available
Parental gene description:
ferritin, heavy polypeptide 1 [Source:HGNC Symbol;Acc:3976]

Genomic region (view in browser)





>retro_mputfur_408
CGTCCTCGGACCGCTCCAAGGCCCCCCGTCGCCGCTCCAGCGCGGTGCAGCCGCTGCCCG
CCGCCGCCTCTCCTCAGCCGCGCCATGACGACCGCATCCCCTTCGCAGGTGCGCCAGAAC
TACCACCAGGACCCGGAGGCCGCCACCAACCGCCAGATCAACCTGGAGCTCTACGCCTCT
TACGTCTATCTATCCATGTCTTACTACTTTGACCGTGATGATGTGGCTTTGAGGAACTTC
GCCAAATAATTTTCTCCACCAATCTCATGAGGAGAGGGAACATGCTGAGAAATTGGTGAA
GCTGCAGAACCAACGAGGTGGCCGAATCTTCCTTCAGGATATCAAGAAACCAGACCGTGA
TGATTGGGAGAATGGGCTGAATGCAATGGAGTGTGCATTACACTTGGAAAAGAGTGTGAA
TCAGTCACTACTGGAACTGCACAAACTGGCCACTGATAAAAATGACCCCCATTTGTGTGA
CTTCATTGAGACTCATTACTTGAATGAGCAGGTAAAATCCATCAAAGAATTGGGTGACCA
CATAACCAACCTGCGCAAGATGGGGGCCCCCGAATCTGGCATGGCAGAGTATCTCTTTGA
CAAGCACACCTTGGGAAACAGTGATAGTGAGAGC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RPLRASPPPSPHSVLGPLQGPPSPAAAATTTASPSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAK-YFLHQSHEEREHAEKLM
RP..A..PP...........PP.....A.TTASPSQVRQNYHQD.EAA.NRQINLELYASYVYLSMSYYFDRDDVAL.NFAK..FLHQSHEEREHAEKL.
Retrocopy
RPRTAPRPPVAAPARCSRCPPPPLLSRAMTTASPSQVRQNYHQDPEAATNRQINLELYASYVYLSMSYYFDRDDVALRNFAK\NFLHQSHEEREHAEKLV


Parental protein
KLQNQRGGRIFLQDIKKPDRDDWENGLNAMECALHLEKSVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKSIKELGDHVTNLRKMG-PESGMAEYLF
KLQNQRGGRIFLQDIKKPDRDDWENGLNAMECALHLEKSVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKSIKELGDH.TNLRKMG.PESGMAEYLF
Retrocopy
KLQNQRGGRIFLQDIKKPDRDDWENGLNAMECALHLEKSVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKSIKELGDHITNLRKMGAPESGMAEYLF


Parental protein
DKHTLGNSDSES
DKHTLGNSDSES
Retrocopy
DKHTLGNSDSES


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide