RetrogeneDB ID:
retro_mputfur_409
Organism:
Location:
GL896907.1:19682341-19683153 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
70.46 %
Coverage:
62.73 %
Frameshifts:
5
Stop codons:
4


Parental gene:
Parental gene symbol:
PSMC1
Parental gene aliases:
No gene alias available
Parental gene description:
proteasome (prosome, macropain) 26S subunit, ATPase, 1 [Source:HGNC Symbol;Acc:9547]

Genomic region (view in browser)





>retro_mputfur_409
CTGCTGGAACCAGGCTGCTCAGTCATACTCATCCACTGGCTACATGCCATCATTGGGATG
CTCATGTTTGACAGGGATCCTTTGGTCACAGTGATGAAGGTAGAAAAGAGCCCTCAGGAA
ACCTATGCTGATATTGGGGGGTTGGTCAACCAAATCCAGGAAATTCAGGAAACTGGAGCT
TCCTCTCTACTCATCCTGAATATTGATGAAGAAATGGGTATAAATACGCCAAAGGAGGTC
ATTATATGATCTATCTGGCACAGGTAAAACCTTATTAGCCAAAGCAGTAGCAAACCAAAC
CTTAGCCCCTTACTTGAAAGTGGTTGGCTCTGAACTTACTCAGAAGTACCTAGGTGATGT
TTGGGAATTGTTTTGCGTTGCTGAAGAACATGTACCATCCATCTGTTTATTGATAAAATT
GATGCAATTGGAACAAAAAGGTATGACTAAAATGCCAGTGGTAAGAAAGGAATTCAATGA
ACAGTTTTGGACTGTTGAATCAGTTGGATGGATTTGACTCAAGGGGTGACATGAAAGTTA
TCATGGCCACAAACCAAATAGGAAGTTTGGATCCAGCACTTATTAGACCAGGCTGCATTG
ACAGAAAGATTGAGTTCTTCCTCCCCAAAGAAAACACTACAAAGCACATCTTTGAGGTCC
ACACAAGCAGGATAATGCTAGCTGATAATGTAACTGTGGACGACTTGATCATGGCTAAAG
ATGACCTGTCTGGTGCCAACATCAAGGCAATCTGTATAGAAGCTGGTCTGATGGCCATGA
GAGAACATAGAAAGAAAGTAACAAATAAAGAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIG-GLDNQIQEIKESVELPL-THPEYYEEMGIKPPKGV-ILYGPPGTGKTLLAKAV
LLEPGCSV.L.H..HA.IG.LM.D.DPLVTVMKVEK.PQETYADIG.G............ELPL.THPEY....G.K..KG...LY...GTGKTLLAKAV
Retrocopy
LLEPGCSVILIHWLHAIIGMLMFDRDPLVTVMKVEKSPQETYADIG\GWSTKSRKFRK-LELPL\THPEY**RNGYKYAKGG/SLYDLSGTGKTLLAKAV


Parental protein
ANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSI-VFIDEIDAIGTKRYDSNSGGEREIQRTMLE-LLNQLDGFDSRGDVKVIMATNRIETL
ANQT.A..L.VVGSEL.QKYLGD....V.ELF.VAEEH.PSI..FID.IDAIGTKRYD.N..G...IQ.T.L..LLNQLDGFDSRGD.KVIMATN.I..L
Retrocopy
ANQTLAPYLKVVGSELTQKYLGD----VWELFCVAEEHVPSI/LFIDKIDAIGTKRYD*NASGKKGIQ*TVLD/LLNQLDGFDSRGDMKVIMATNQIGSL


Parental protein
DPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNED
DPALIRPG.IDRKIEF.LP.E.T.K.IF..HTSR..LAD.VT.DDLIMAKDDLSGA.IKAIC.EAGLMA.RE.R.KVTN.D
Retrocopy
DPALIRPGCIDRKIEFFLPKENTTKHIFEVHTSRIMLADNVTVDDLIMAKDDLSGANIKAICIEAGLMAMREHRKKVTNKD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide