RetrogeneDB ID:
retro_mputfur_410
Organism:
Location:
GL896907.1:25868216-25868688 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
71.25 %
Coverage:
75.48 %
Frameshifts:
2
Stop codons:
3


Parental gene:
Parental gene symbol:
RPL7
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L7 [Source:HGNC Symbol;Acc:10363]

Genomic region (view in browser)





>retro_mputfur_410
CTTCTTGGGATCAGAGATGTCAATGGTGTGAACTCAAAGGTTTGAAAGGTGTTGCTGCTT
CTTTGCCTTCATCAGATCTTCAGTGGCACCTTGGTAAGTTCAACAAGGCTTCAGTTAACA
TCCTAACAATTGTGGAACCATATATAGCATGGGGATATCCAAACTTGAAACCAGTGAATA
AATTTATCTATGAGTGTGGTGATGGCAAAATAAGTAAGAAGTGCATTGCCCTGACAGACA
ACATGTTGATTGAGCAATCTCTTGGTATATATGGCAGCATCTGCATGGGGGAGGATCTGA
TTCACAAGGTCTATAATGTGGGAAAACATTTCAAAGAAGCAAACAACTTCTTATAGCCCT
TCAAATTACCTACTCCATGAGGGGAATGAAGAAAAAGACCATCCATTTTGTTGAAGGTGG
ATATGCTGGTGACAGAGAGGACCAGATCAGTAGGACTATTAGTAGGATGAAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VIRIRGINGVSPKVRKVLQLLRLRQIFNGTFV-KLNKASVNMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNTLIARSLGKYGIICM-ED
...IR..NGV..KV.KVL.LL.L.QIF.GT.V.K.NKASVN.L.IVEPYIAWGYPNLK.VN..IY..G.GKI.KK.IALTDN.LI..SLG.YG.ICM.ED
Retrocopy
LLGIRDVNGVNSKV*KVLLLLCLHQIFSGTLV/KFNKASVNILTIVEPYIAWGYPNLKPVNKFIYECGDGKISKKCIALTDNMLIEQSLGIYGSICMGED


Parental protein
LIHEIYTVGKRFKEANNFLWPFKLSSPRG-GMKKKTTHFVEGGDAGNREDQINRLIRRMN
LIH..Y.VGK.FKEANNFL.PFKL..P.G.GMKKKT.HFVEGG.AG.REDQI.R.I.RMN
Retrocopy
LIHKVYNVGKHFKEANNFL*PFKLPTP*G/GMKKKTIHFVEGGYAGDREDQISRTISRMN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide