RetrogeneDB ID:
retro_mputfur_412
Organism:
Location:
GL896907.1:26920482-26921191 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
65.83 %
Coverage:
97.12 %
Frameshifts:
2
Stop codons:
6


Parental gene:
Parental gene symbol:
RPS3
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S3 [Source:HGNC Symbol;Acc:10420]

Genomic region (view in browser)





>retro_mputfur_412
ATGGTGGTGCAAATTTCCAAGAAGAGAAGTTTGTTTCCAATGGCATCTTTAAAGCTGAAC
TGAATGAATTTCTCACTTACAAAGTGAGTAATGGCTGAAGATGGCTACTCTGGGGTTGAG
GTCTGAATTACACCAACTAGGAGAGAAATCGATGTCTTGGCCATCAGGACACAGAATGTT
CTCGGTGAGAAGGGCTAGCAGATCTGGGAATTGACCACTGGGTTCAGAAGAGGCTTGATT
TGCGGGGTACAGGGTAGAACTTTAAATTGAAAAGGTGACCACAAGAGGTTTGTGTGCTAT
TACTAGGGCAGAGTCTCTCTGATACAAACTCCTAAGAGGACCTGCTGTGCAGAGGGCCTG
TTATGATGTACGGCAGTTCATCATGAAGTGTGGGGCCAAAAGCTGTGAGATCTTGGTGTC
TGAGAAAGTGCAAGGACAGAGGGCTAAATTTATGATGTTTTTAGATAGCCTGATGATTCA
CAGTGGGAACCCTAACTACTGTGTTGACACTGTTGTGTACCATGTGCTCCTCAGATGGGA
TGTGCTAGGCATCAAAGTGAAGATCATGCTTCCCAGGGACCCAAGTAGTAAGATTGGCTC
CAAGAAGCCCATGCTTGATCATGTGAGAGTTGTGGAACCCAAAGATGAGATATTGCCTAC
CACCCCCATCTTGGAACAGAAGGATGGGAATCTAAAGCGTCCTGCTATG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAVQISKKRKFVADGIFKAE-LNEFLTR-ELAEDGYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELTAV-VQKRFG-FPEGSVELYAEKVATRGL
M.VQISKKR........K....N..LT....AEDGYSGVEV..TPTR.EI..LA.RTQNVLGEKG..I.ELT...VQKR...F....VEL..EKV.TRGL
Retrocopy
MVVQISKKRSLFPMASLKLN*MNFSLTK*VMAEDGYSGVEV*ITPTRREIDVLAIRTQNVLGEKG*QIWELTTG/VQKRLD/FAGYRVEL*IEKVTTRGL


Parental protein
CAIAQAESLRYKLLGGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPSG
CAI..AESL.YKLL.G.AV.RACY.V..FIM..GAK.CE..VS.K..GQRAK.M.F.D.LMIHSG.P.NY.VDT.V.HVLLR..VLGIKVKIMLP.DPS.
Retrocopy
CAITRAESL*YKLLRGPAVQRACYDVRQFIMKCGAKSCEILVSEKVQGQRAKFMMFLDSLMIHSGNP-NYCVDTVVYHVLLRWDVLGIKVKIMLPRDPSS


Parental protein
KIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAM
KIG.KKP..DHV..VEPKDEILPTTPI.EQK.G....PAM
Retrocopy
KIGSKKPMLDHVRVVEPKDEILPTTPILEQKDGNLKRPAM


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide