RetrogeneDB ID:
retro_mputfur_413
Organism:
Location:
GL896908.1:135768-136121 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
56.2 %
Coverage:
87.5 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
RPL27
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L27 [Source:HGNC Symbol;Acc:10328]

Genomic region (view in browser)





>retro_mputfur_413
TACTGCCAAGGCAAAGTGGTCCTTGAGAAGAGCACTGATGATTGCCACCTCAAACCAACC
CTATAGTCATGCTCTGGGTGCTGGAATTGACCATTATCCCAACAAAGTGATAGTTGCCAT
GGGCAAGAAAAGGTCAAAGATAAATGATTTGATAATCTTTTGTGAAAATTTGTAACCATA
ATCACTTTATGACCACAAGTTACCCTGCAGGTATCCTCTTAGACAAACCTGTTGGCAGCA
AGGATGTGTTCAGGAACCCTGCTCTTAAATACAAGGCCTGACGAAGGGCTGAAGTTGAGT
TCAATATATACAAGACCAGCAAGAGCAAACGGCTCTTCCAGAAGCTGCAGTTT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
YSGRKAVIVKNIDD-GTSDRPYSHALVAGIDRYPRKVTAAMGKKKIAKRSKIK-SFVKVYNYNHLMPTRYSVDIPLDKTVVNKDVFRDPALKRKARREAK
Y...K.V..K..DD..TS..PYSHAL.AGID.YP.KV..AMG.KK..K......SFVK..N.NH.M.T.Y...I.LDK.V..KDVFR.PALK.KA.R.A.
Retrocopy
YCQGKVVLEKSTDD\ATSNQPYSHALGAGIDHYPNKVIVAMG-KKRSKINDLI\SFVKICNHNHFMTTSYPAGILLDKPVGSKDVFRNPALKYKA*RRAE


Parental protein
VKFEERYKTGKNKWFFQKLRF
V.F...YKT.K.K..FQKL.F
Retrocopy
VEF-NIYKTSKSKRLFQKLQF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide