RetrogeneDB ID:
retro_mputfur_415
Organism:
Location:
GL896908.1:13006851-13007628 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
84.79 %
Coverage:
74.29 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
Ist1
Parental gene aliases:
No gene alias available
Parental gene description:
increased sodium tolerance 1 homolog (yeast) [Source:MGI Symbol;Acc:MGI:1919205]

Genomic region (view in browser)





>retro_mputfur_415
TTCAGGCAGGAGGAACAGCACAGCATGCTGGGCTCTGGATTTAAAGCTGAGCGTTTACGA
GTCAATTTGAGATTAGTCATAAACCGTCTTAAACTGTTGGAGAAAAAAAAAACGGAACTG
GCCCAGAAAGCGAGGAAAGAGATTGCTGACTATCTGGCTGCTGGGAAAGATGAACGAGCT
CGGATTCGAGTGGAGCACATTATCCGAGAAGACTACCTTGTGGAGGCCATGGAGATTCTG
GAGCTGTATTGTGATCTGCTGCTGGCTCGGTTTGGCCTCATCCAATCTATGAAGGAACTA
GACTCTGGTCTGGCCGAATCCGTGTCTACGCTGATATAGGCTGCTCCTCGGCTCCAGTCA
GAAGTGGCTGAGTTGAAAATAGTTGCTGATCAGCTCTGTGCCAAGTATAGCAAGGAATAT
GGCAAGCTATGTAGGACCAATCAGATTGGAACTGTGAATGACAGGCTGATGCACAAACTG
AGTGTGGAAGCCCCACCTAAAATCCTGGTGGAGAGATACCTGATTGAAATTGCCAATAAC
TACAATGTGCCCTATGAGCCTGACTCTGTGGTCATGGCAGAAGCTCCTCCTGGGGTAGAG
ACAGATCTTATTGATGTTGGATTCACAGATGATGTGAAGAAAGGGGGCCCTGGAAGAGGA
GGAAGGGGTGGTTTCACAGCACCAATTGGTGGACCTGATGGAACAGTACCAGTGCCTATG
CCCATGCCCTCTCCAAGTACTCCTTTCTCCTACCCACTGCCAAAGGGACCAGTTGAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
FFQEEQHSMLGSGFKAERLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHIIREDYLVEAMEILELYCDLLLARFGLIQSMKEK
F.QEEQHSMLGSGFKAERLRVNLRLVINRLKLLE....ELAQKARKEIADYLAAGKDERARIRVEHIIREDYLVEAMEILELYCDLLLARFGLIQSMKE.
Retrocopy
FRQEEQHSMLGSGFKAERLRVNLRLVINRLKLLEXXXXELAQKARKEIADYLAAGKDERARIRVEHIIREDYLVEAMEILELYCDLLLARFGLIQSMKEL


Parental protein
EHACAGGVGGVERWVEEQRERIILLRCVADQLCAKYSKEYGKLCRTNQIGTVNDRLMHKLSVEAPPKILVERYLIEIAKNYNVPYEPDSVVMAEAPPGVE
....A..V................L..VADQLCAKYSKEYGKLCRTNQIGTVNDRLMHKLSVEAPPKILVERYLIEIA.NYNVPYEPDSVVMAEAPPGVE
Retrocopy
DSGLAESVSTLI*AAPRLQSEVAELKIVADQLCAKYSKEYGKLCRTNQIGTVNDRLMHKLSVEAPPKILVERYLIEIANNYNVPYEPDSVVMAEAPPGVE


Parental protein
TDLIDVGFTDDVKKGGPGRGGGGGFAAPIGGPDGTVPVPMPMPMPMPSPSTPFSYPLQKGPSD
TDLIDVGFTDDVKKGGPGRGG.GGF.APIGGPDGTVPVPMPMP.P....STPFSYPL.KGP.D
Retrocopy
TDLIDVGFTDDVKKGGPGRGGRGGFTAPIGGPDGTVPVPMPMPSP----STPFSYPLPKGPVD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide